MyVidster Tag results for naval

navy launches first aircraft using emals
Bookmarked 794 weeks ago
lakehurst nj dec 18 2010 the navy launches the first aircraft an fa-18e super hornet from the electromagnetic aircraft launch system emals at naval air systems command lakehurst nj the navy has used steam catapults for more than 50 years to launch aircraft from aircraft carriers emals is a complete carrier-based launch system designed for gerald r ford cvn 78 and future ford-class carriers newer heavier and faster aircraft will result in launch energy requirements approaching the limits of the steam catapult increasing maintenance on the system the system039s technology allows for a smooth acceleration at both high and low speeds increasing the carrier039s ability to launch aircraft in support of the warfighter emals will provide the capability for launching all current and future carrier air wing platforms from lightweight unmanned aerial vehicles to heavy strike fighters the first ship components are on schedule to be delivered to cvn 78 in 2011 us navy videoreleased

battle of midway 1942 raw wwii footage
Bookmarked 125 weeks ago
on the japanese aerial attack on midway island and us ships in the area shows activities before during and after the attack

bismark convoy smashed footage of 1943 naval action in the bismark sea ww2wwii
Bookmarked 114 weeks ago
this film quotthe bismark convoy smashedquot was released in 1943 by the australian government039s department of information

pensacola naval air station shooting: shooter dead motive unclear nbc news
Bookmarked 327 weeks ago
nbc news pete williams reports at least five people were transported to local hospitals after a shooting at the naval air station pensacola in florida this is the second shooting at a us military facility this week subscribe to nbc news: http:nbcnewstosubscribetonbc watch more nbc video: http:bitlymorenbcnewsnbc news digital is a collection of innovative and powerful news brands that deliver compelling diverse and engaging news stories nbc news digital features nbcnewscom msnbccom todaycom nightly news meet the press dateline and the existing apps and digital extensions of these respective properties we deliver the best in breaking news live video coverage original journalism and segments from your favorite nbc news showsconnect with nbc news onlinenbc news app: https:appsnbcnewscommobilebreaking news alerts: https:linknbcnewscomjoin5cjbreaking-news-signupcid=sm_npd_nn_yt_bn-clip_190621visit nbcnewscom: http:nbcnewstoreadnbcfind nbc news on faceb

oak knoll naval hospital demolition
Bookmarked 778 weeks ago
night photographs of oak knoll: http:bitlygvnvabmore info on the time-lapse and video of the implosion of oak knoll hospital in oakland california on april 8 2011: http:bitlyerd4an

royal naval field gun competition 1999 not the quotlastquot
Bookmarked 571 weeks ago
not the lastnot by any means the last but nevertheless regarded by many as the last because it was the last with full-sized guns over the full earl039s court course therefore many regard it as being the last whereas it is not strictly speaking the last quotlastquot royal naval field gun race faa versus portsmouth note the black armbandsplease note that when the commentator refers to this as the quotlastquot field gun race he means that to his knowledge at that time this would be the last field gun race ie the last with full-sized guns over the full earl039s court course whereas in the broader sense it is not in actual fact the last quotlastquot as the race continues to be run in various guises to this very day108 years have passed and ladysmith belongs to the zulu kingdom of kwazulu-natal but the feat of the gunners from quotpowerfulquot and quotterriblequot has never been forgottenhttp:ladysmithkznorgzalsindexhtml

activists rally against new s korea navy base
Bookmarked 760 weeks ago
peace activists and locals are protesting against the south korean government039s plans to build a new naval base on an island off the country039s south coastthe protesters in gangjeong the village in which the base is slated to be built say they are not willing to cede an inch of the village for the base which they say serves to help the us contain china039s growing military powerthe government says it will press on with the 90m project as it will allow the military to swiftly respond to any future threats from north koreaal jazeera039s harry fawcett reports from jeju island

assassins creed rogue story trailer us
Bookmarked 595 weeks ago
in assassins creed rogue youll learn the dark secret that led shay to betray the brotherhood and follow the darker path of the templar order from the streets of new york to the thrilling naval combat and exploration in the perilous arctic shay will chase down new foes and even a few familiar faces watch as he follows his own creed to hunt down every last assassin he can to end the brotherhood once and for allplease subscribe and visit our official channels for exclusive access and the latest information on all things assassins creed:http:wwwassassinscreedcomhttp:wwwyoutubecomassassinscreedhttp:wwwfacebookcomassassinscreedhttp:wwwtwittercomassassinscreedhttp:wwwinstagramcomassassinscreedhttp:assassinscreedtumblrcomassassins creed rogue is a brand new chapter in the blockbuster assassins creed universe play as shay an assassin who finds himself at a crossroads and ultimately turns his back on the brotherhood in order to hunt them down assassins creed rogue will be available exclusively on xbox 360 and playstation 3 november 11th and on pc in early 2015 play as an all-new type of assassin in the throes of a dark transformation from loyal assassin to hunting down his former allies in the assassins brotherhood new weapons such as the deadly air rifle and a variety of ammunition as well as specialized grenades can be used to distract eliminate or confuse enemies use shays enhanced eagle vision and locate hidden assassins to either avoid or eliminate them sail the icy and perilous seas of the north atlantic for thrilling naval gameplay including new enemy tactics exotic new weapons and an arctic world full of icebergs and other dangers explore a diverse open world from the city streets of new york city to the lush river valleys to the ice-filled seas of the north atlantic ocean 2014 ubisoft entertainment all rights reserved assassins creed unity and ubisoft and the ubisoft logo are trademarks of ubisoft entertainment in the us andor other countries

russian submarine
Bookmarked 741 weeks ago
russian nuclear submarines in training start-up of ballistic missiles in the arctic ocean nato apparently derived the name 039typhoon039 from a 1974 speech by leonid brezhnev which mentioned a new ssbn called the quottayfunquot in fact the russian name for the class is quotakulaquot -- quotsharkquot during the cold war the typhoon submarines prowled the waters of the north atlantic the typhoon is the world039s largest submarine and was one of the most feared weapons of the cold war each submarine is capable of carrying twenty long-range ballistic missiles rsm-52 ss-n-20 ballistic missiles now ss-n-28 new russian ballistic missiles with up to 200 nuclear warheads that were once aimed at the united states the design of the typhoon submarine is multi-hulled and bears resemblance to a catamaran the submarine has two separate pressure hulls with a diameter of 72 m each five inner habitable hulls and 19 compartments the pressure hulls are arranged parallel to each other and symmetrical to a centerplane the missile compartment is arranged in the upper part of the bow between the pressure hulls both hulls and all compartments are connected by transitions the pressure hulls the centerplane and the torpedo compartment are made of titanium and the outer light hull is made of steel a protected module comprising the main control room and electronic equipment compartment is arranged behind the missile silos above the main hulls in a centerplane under the guard of retractable devicesthe submarine039s design includes features to enable it to both travel under ice and for ice-breaking it has an advanced stern fin with horizontal hydroplane fitted after the screws the nose horizontal hydroplanes are in the bow section and are retractable into the hull the retractable systems include two periscopes one for the commander and one for general use radio sextant radar radio communications navigation and direction-finder masts they are housed within the sail guard the sail and sail guard have a reinforced rounded cover for ice-breaking this fastest weapon for 2-3 minute apocalypse for any military opponent god bless never do it

electromagnetic railgun firing hypervelocity projectile mach 7
Bookmarked 345 weeks ago
watch hyper velocity projectile hvp being demonstrated at us navy039s research labsthe hvp is a next-generation common low drag guided projectile capable of completing multiple missions for gun systems such as the navy 5-inch 155-mm and future railguns types of missions performed will depend on gun system and platform the program goal is to address mission requirements in the areas of naval surface fire support cruise missile defense anti-surface warfare and other future naval mission areas hvps low drag aerodynamic design enables high-velocity maneuverability and decreased time-to-target these attributes coupled with accurate guidance electronics provide low-cost mission effectiveness against current threats and the ability to adapt to air and surface threats of the future wwwonrnavymilenmedia-centerfact-sheetshypervelocity-projectileaspxquotenergetic weapons such as em railguns are the future of naval combatquot said rear adm matt klunder the chief of naval re

keelhauling - one of the worst forms of punishment in naval history
Bookmarked 351 weeks ago
keelhaulingone of the most brutal forms of punishment in naval historywho has not heard of it keelhauling is a form of physical punishment which was used on pirate ships and in several navies such the english dutch and french navy of the 17th to the 19th-century because keelhauling was performed publicly it had an exemplarily character on board of these ships keelhauling was used rarely and only in cases of violence against comrades or civilians or in cases of mutiny among the different practices of keelhauling the worst form was to drag the victims along the ships keel the keel is a structural element of the ship which runs along the central line of the boat and resembles a ridge the meaning of keelhauling derived from the dutch keelhalen is precisely to drag along the keel music: drunken sailor by the midshipmen glee club sources:quotdiplomatarium norvegicumquot arkivverket retrieved january 1 2017falconer w an universal dictionary of the marine 1784merriam-

attack on pearl harbor 1941
Bookmarked 423 weeks ago
animated battle mapi do not own the rights to the songs or images this video is purely for educational purposes credit-no copyright intended all image rights go to:-wikipedia commonshttps:commonswikimediaorgwikiba-naval history heritage and commandhttps:wwwhistorynavymilimages contained on this site that are donated from private sources are copyrighted by the respective owner images credited to the national archives na nara naval history amp heritage command nhhc formerly naval historical center nhc and us navy usn are believed to be in the public domain some images credited to the united states naval institute usni are from copyrighted collections the rest are believed to be in the public domainno copyright intended all music rights go to:ncm epic music ender guneyhttps:wwwyoutubecomchannelucheioeoqyfpsoiw8cepdaygsources:kinzey b amp roszak r 2010 attack on pearl harbor: japan awakens a sleeping giant blacksburg

fa-18 carrier break and landing - youtube
Bookmarked 254 weeks ago
pacific ocean recovery of a vfa-14 tophatters fa-18e super hornet

the battle of the coral sea 1942: the first aircraft carrier battle in history
Bookmarked 402 weeks ago
to cut to the chase and skip all the preliminary actions of may 4-7 go to 18:43 to see the main carrier battlesources:lundstrom j b 2013 the first team pacific naval air combat from pearl harbor to midway new york: naval institute presslundstrom j b 2014 the first south pacific campaign: pacific fleet strategy december 1941-june 1942 annapolis md: naval institute pressstille m 2009 the coral sea 1942: the first carrier battle vol 214 campaign oxford: osprey publishingtoll i w 2012 pacific crucible: war at sea in the pacific 1941-1942 new york: ww nortonwillmott h p 2008 the barrier and the javelin: japanese and allied strategies february to june 1942 annapolis md: naval institute pressno copyright intended all image rights go to:-wikipedia commonshttps:commonswikimediaorgwikiba-naval history heritage and commandhttps:wwwhistorynavymilmusic:marvel style cinematic musicdescription: https:wwwyoutubecomcncmepicmus

assassins creed rogue remastered: announcement teaser trailer ubisoft us
Bookmarked 425 weeks ago
assassins creed rogue the darkest chapter of the brotherhood will now be remastered in higher quality and available on xbox one and playstation 4 available on march 20th please subscribe and visit our official channels for exclusive access and the latest information on all things assassins creed:assassinscreedhttps:assassinscreedcom https:wwwfacebookcomassassinscreedushttps:instagramcomassassinscreed_ushttps:twittercomassassinscreedhttp:wwwyoutubecomubisoftusabout assassins creed rogue:introducing assassins creed rogue the darkest chapter in the assassins creed franchise yetas shay you will experience the slow transformation from assassin to assassin hunter follow your own creed and set off on an extraordinary journey through new york city the wild river valley and far away to the icy cold waters of the north atlantic in pursuit of your ultimate goal to bring down the assassins 18th century north america amidst the chaos and violence of the f