collect the videos you love
collect | share | explore
Tag results for naval
sort by: relevance | recent
Results from all user's collections (77 out of ~77)
The results from your search appear low, try our web search for better results.
molly meredith tickled

watch molly meredith tickled 2014 runtime: 08:12 categories: cute belly tickle meredith naval hornyhill hornyhillse
ag barr says attack at naval air station pensacola an act of terrorism

us attorney general bill barr and fbi deputy director david bowdich will hold a press conference at the justice department announcing the findings of the criminal investigation into the december 6 shootings at the pensacola naval air station in florida that killed three us service members and wounded eight foxnewsfox news operates the fox news channel fnc fox business network fbn fox news radio fox news headlines 247 foxnewscom and the direct-to-consumer streaming service fox nation fox news also produces fox news sunday on fox broadcasting company and fox news edge a top five-cable network fnc has been the most watched news channel in the country for 17 consecutive years according to a 2018 research intelligencer study by brand keys fox news ranks as the second most trusted television brand in the country additionally a suffolk universityusa today survey states fox news is the most trusted source for television news or commentary in the country while a 2017 gallupknight foundatio
pensacola naval air station shooting: shooter dead motive unclear nbc news

nbc news pete williams reports at least five people were transported to local hospitals after a shooting at the naval air station pensacola in florida this is the second shooting at a us military facility this week subscribe to nbc news: http:nbcnewstosubscribetonbc watch more nbc video: http:bitlymorenbcnewsnbc news digital is a collection of innovative and powerful news brands that deliver compelling diverse and engaging news stories nbc news digital features nbcnewscom msnbccom todaycom nightly news meet the press dateline and the existing apps and digital extensions of these respective properties we deliver the best in breaking news live video coverage original journalism and segments from your favorite nbc news showsconnect with nbc news onlinenbc news app: https:appsnbcnewscommobilebreaking news alerts: https:linknbcnewscomjoin5cjbreaking-news-signupcid=sm_npd_nn_yt_bn-clip_190621visit nbcnewscom: http:nbcnewstoreadnbcfind nbc news on faceb
constana shipyard antierul naval constana filmed in 4k

constana shipyard antierul naval constana is the largest shipyard in romania and one of the largest in europe here the dockyard was filmed from the north and from the west in the film can be seen the rail lines which connects the port with the rail network the port of constana is the largest on the black sea in the distance can be seen the old town of constanaltbrgtltbrgtantierul naval constana i portul constana filmate dinspre oseaua portului i strada viitorului n deprtare se poate vedea cele mai nalte cldiri din centrul vechi al constanei
electromagnetic railgun firing hypervelocity projectile mach 7

watch hyper velocity projectile hvp being demonstrated at us navy039s research labsthe hvp is a next-generation common low drag guided projectile capable of completing multiple missions for gun systems such as the navy 5-inch 155-mm and future railguns types of missions performed will depend on gun system and platform the program goal is to address mission requirements in the areas of naval surface fire support cruise missile defense anti-surface warfare and other future naval mission areas hvps low drag aerodynamic design enables high-velocity maneuverability and decreased time-to-target these attributes coupled with accurate guidance electronics provide low-cost mission effectiveness against current threats and the ability to adapt to air and surface threats of the future wwwonrnavymilenmedia-centerfact-sheetshypervelocity-projectileaspxquotenergetic weapons such as em railguns are the future of naval combatquot said rear adm matt klunder the chief of naval re
the romans flooded the colosseum for sea battles - janelle peters

dig in to the history of the roman empires staged gladiatorial naval battles and how they flooded the colosseum to reenact famous battles--starting in 80 ce residents of rome and visitors from across the roman empire would fill the stands of the colosseum to see gladiators duel animals fight and chariots race around the arena and for the grand finale water poured into the arena basin submerging the stage for the greatest spectacle of all: staged naval battles janelle peters details the history of these mock maritime encounterslesson by janelle peters directed by brett underhillsign up for our newsletter: http:bitlytedednewslettersupport us on patreon: http:bitlytededpatreonfollow us on facebook: http:bitlytededfacebookfind us on twitter: http:bitlytededtwitterpeep us on instagram: http:bitlytededinstagramview full lesson: https:edtedcomlessonshow-the-romans-flooded-the-colosseum-for-sea-battles-janelle-petersthank you so much to our patrons for your suppor
keelhauling - one of the worst forms of punishment in naval history

keelhaulingone of the most brutal forms of punishment in naval historywho has not heard of it keelhauling is a form of physical punishment which was used on pirate ships and in several navies such the english dutch and french navy of the 17th to the 19th-century because keelhauling was performed publicly it had an exemplarily character on board of these ships keelhauling was used rarely and only in cases of violence against comrades or civilians or in cases of mutiny among the different practices of keelhauling the worst form was to drag the victims along the ships keel the keel is a structural element of the ship which runs along the central line of the boat and resembles a ridge the meaning of keelhauling derived from the dutch keelhalen is precisely to drag along the keel music: drunken sailor by the midshipmen glee club sources:quotdiplomatarium norvegicumquot arkivverket retrieved january 1 2017falconer w an universal dictionary of the marine 1784merriam-
chinese pj26 76mm naval gun test

chinese pj26 76mm naval gun test
the battle of the coral sea 1942: the first aircraft carrier battle in history

to cut to the chase and skip all the preliminary actions of may 4-7 go to 18:43 to see the main carrier battlesources:lundstrom j b 2013 the first team pacific naval air combat from pearl harbor to midway new york: naval institute presslundstrom j b 2014 the first south pacific campaign: pacific fleet strategy december 1941-june 1942 annapolis md: naval institute pressstille m 2009 the coral sea 1942: the first carrier battle vol 214 campaign oxford: osprey publishingtoll i w 2012 pacific crucible: war at sea in the pacific 1941-1942 new york: ww nortonwillmott h p 2008 the barrier and the javelin: japanese and allied strategies february to june 1942 annapolis md: naval institute pressno copyright intended all image rights go to:-wikipedia commonshttps:commonswikimediaorgwikiba-naval history heritage and commandhttps:wwwhistorynavymilmusic:marvel style cinematic musicdescription: https:wwwyoutubecomcncmepicmus
why did sailors swab the deck - naval history animated

this video is going to answer one simple question: why did sailors swab the deck this is one of the first videos in an animated naval history series i039m doingsailors swabbed the deck for several reasons the first being to clean and preserve the deck by working salt water into the wood of the deck it prevented the growth of fungus and washed freshwater away which would rot the wood the second reason was that it swelled the wood making the ship more watertight surprisingly a dry ship was a ship with wet wood--------------------------------------------- about me:---------------------------------------------i039m imperial scribe i make animations about military and naval history as well as war theory i put out 1-2 major battle videos per month with a number of shorter videos in betweenmy twitter:subscribe:--------------------------------------------- suggestions:---------------------------------------------the british empires battleship the ship of t
uss forrestal c-130 hercules carrier landing trials

the c-130 hercules holds the record for the largest and heaviest aircraft to land on an aircraft carrier in october and november 1963 a usmc kc-130f buno 149798 bailed to the us naval air test center made 21 unarrested landings and take-offs on the uss forrestal at a number of different weights the pilot lt later radm james flatley iii usn was awarded the distinguished flying cross for his participation the tests were highly successful but the idea was considered too risky for routine quotcarrier onboard deliveryquot cod operations instead the c-2 greyhound was developed as a dedicated cod aircraft the hercules used in the test most recently in service with marine aerial refueler squadron 352 vmgr-352 until 2005 is now part of the collection of the national museum of naval aviation at nas pensacola florida
assassin039s creed odyssey: e3 2018 official world premiere trailer ubisoft na

watch the world premiere of assassins creed odyssey set in ancient greece a world rich with myths and legendsassassinscreedodyssey ubie3website - http:bitly2t7jeqz https:wwwfacebookcomassassinscreedushttps:instagramcomassassinscreed_ushttps:twittercomassassinscreedhttps:wwwyoutubecomubisoftnaabout assassins creed odyssey:become a legendary spartan hero embark on your journey from humble beginnings to living legend as alexios or kassandra customize your gear upgrade your abilities and personalize your ship on your path to becoming a spartan hero ancient greece awaits from the heights of snowy mountain peaks to the depths of the aegean sea explore an entire country full of untamed environments and cities at the peak of greeces golden age unexpected encounters will breathe life into your story as you meet colorful characters battle vicious mercenaries and more choose your own path your decisions shape the world around you with over 30 hours of choic
assassin039s creed odyssey: e3 2018 gameplay walkthrough ubisoft na

watch the first ever gameplay walkthrough of assassins creed odyssey visit the beautiful mykonos city in ancient greece where our spartan hero kassandra prepares for her next adventure assassins creed odyssey will feature dialogue options weapons and combat ability customization naval ship battles and a world rich with myths and legends assassinscreedodyssey ubie3website - http:bitly2t7jeqz https:wwwfacebookcomassassinscreedushttps:instagramcomassassinscreed_ushttps:twittercomassassinscreedhttps:wwwyoutubecomubisoftnaabout assassins creed odyssey:become a legendary spartan heroembark on your journey from humble beginnings to living legend as alexios or kassandra customize your gear upgrade your abilities and personalize your ship on your path to becoming a spartan hero ancient greece awaits from the heights of snowy mountain peaks to the depths of the aegean sea explore an entire country full of untamed environments and cities at the peak of greece
assassin039s creed odyssey: e3 2018 official world premiere trailer ubisoft na

watch the world premiere of assassins creed odyssey set in ancient greece a world rich with myths and legendsassassinscreedodyssey ubie3website - http:bitly2t7jeqz https:wwwfacebookcomassassinscreedushttps:instagramcomassassinscreed_ushttps:twittercomassassinscreedhttps:wwwyoutubecomubisoftnaabout assassins creed odyssey:become a legendary spartan hero embark on your journey from humble beginnings to living legend as alexios or kassandra customize your gear upgrade your abilities and personalize your ship on your path to becoming a spartan hero ancient greece awaits from the heights of snowy mountain peaks to the depths of the aegean sea explore an entire country full of untamed environments and cities at the peak of greeces golden age unexpected encounters will breathe life into your story as you meet colorful characters battle vicious mercenaries and more choose your own path your decisions shape the world around you with over 30 hours of choic
attack on pearl harbor 1941

animated battle mapi do not own the rights to the songs or images this video is purely for educational purposes credit-no copyright intended all image rights go to:-wikipedia commonshttps:commonswikimediaorgwikiba-naval history heritage and commandhttps:wwwhistorynavymilimages contained on this site that are donated from private sources are copyrighted by the respective owner images credited to the national archives na nara naval history amp heritage command nhhc formerly naval historical center nhc and us navy usn are believed to be in the public domain some images credited to the united states naval institute usni are from copyrighted collections the rest are believed to be in the public domainno copyright intended all music rights go to:ncm epic music ender guneyhttps:wwwyoutubecomchannelucheioeoqyfpsoiw8cepdaygsources:kinzey b amp roszak r 2010 attack on pearl harbor: japan awakens a sleeping giant blacksburg