Tag results for patrick
sort by: relevance | recent
Results from Popular YouTube Videos (180 out of ~180)
|
the man who tried to give himself an ulcer for science
Bookmarked 452 weeks ago in 1984 dr barry marshall had a theory about ulcers that he couldn039t convince the science community of so he took matters into his own hands or stomach and infected himself with a potentially deadly bacterium hosted by: michael aranda----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporterswe couldn039t make scishow without them shoutout to kevin bealer mark terrio-cameron katiemarie magnone patrick merrithew charles southerland fatima iqbal sultan alkhulaifi tim curwick scott satovsky jr philippe von bergen bella nash chris peters patrick d ashmore piya shedden charles george----------looking for scishow elsewhere on the internetfacebook: http:wwwfacebookcomscishowtwitter: http:wwwtwittercomscishowtumblr: http:scishowtumblrcominstagram: http:instagramcomthescishow----------sources:https:medlineplusgovpepticulcerhtmlhttp:discovermagazin |
|
why can039t you use your phone on a plane
Bookmarked 459 weeks ago whether you039ve got the latest iphone or the same flip phone you039ve had since 2002 you039re still asked to turn off your device before take off why is thathosted by: michael aranda----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporterswe couldn039t make scishow without them shout out to kevin bealer mark terrio-cameron katiemarie magnone patrick merrithew charles southerland fatima iqbal benny tim curwick scott satovsky jr philippe von bergen bella nash bryce daifuku chris peters patrick d ashmore charles george bader alghamdi----------looking for scishow elsewhere on the internetfacebook: http:wwwfacebookcomscishowtwitter: http:wwwtwittercomscishowtumblr: http:scishowtumblrcominstagram: http:instagramcomthescishow----------sources: |
|
why do we eat raw fish but not raw chicken
Bookmarked 469 weeks ago we might order fish raw but why don039t we ever order chicken that wayhosted by: hank green----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporterswe couldn039t make scishow without them shout out to kevin bealer mark terrio-cameron katiemarie magnone patrick merrithew charles southerland fatima iqbal benny kyle anderson tim curwick scott satovsky jr will and sonja marple philippe von bergen bella nash bryce daifuku chris peters patrick d ashmore charles george bader alghamdi----------looking for scishow elsewhere on the internetfacebook: http:wwwfacebookcomscishowtwitter: http:wwwtwittercomscishowtumblr: http:scishowtumblrcominstagram: http:instagramcomthescishow----------sources:http:timecom3731226you-asked-why-cant-i-eat-raw-meathttps:wwwcdcgovparasitesanisakiasisfaqshtmlhttp:wwwfdagovdownloadsfoodguidanceregulationucm2523 |
|
9 weird ways animals communicate
Bookmarked 499 weeks ago we all know ducks quack dogs bark and birds chirp but that barely scratches the surface of all the amazing ways animals have devised to talk to each otherdemon mole rat images: http:wwwwiredcom201310head-banging-demon-mole-rats-just-want-to-be-left-alonehosted by: micheal aranda ----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporters -- we couldn039t make scishow without them shout out to kathy amp tim philip kevin bealer andreas heydeck thomas j accalia elementia will and sonja marple james harshaw justin lentz chris peters bader alghamdi benny tim curwick philippe von bergen patrick merrithew fatima iqbal mark terrio-cameron patrick d ashmore and charles george----------like scishow want to help support us and also get things to put on your walls cover your torso and hold your liquids check out our awesome products over at dftba records: http:dftbacomsci |
|
what really happened with typhoid mary
Bookmarked 483 weeks ago the famous symptomless carrier of typhoid fever mary mallon never felt the effects of the fever but never recovered from a medical system that didnt know how to treat a carrier of the diseasehosted by: michael aranda----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporters -- we couldn039t make scishow without them shout out to james harshaw kevin bealer mark terrio-cameron patrick merrithew accalia elementia charles southerland fatima iqbal benny kyle anderson tim curwick will and sonja marple philippe von bergen bryce daifuku chris peters kathy philip patrick d ashmore charles george bader alghamdi----------like scishow want to help support us and also get things to put on your walls cover your torso and hold your liquids check out our awesome products over at dftba records: http:dftbacomscishow----------looking for scishow elsewhere on the internetfacebook: htt |
|
7 things you should know about bed bugs
Bookmarked 481 weeks ago 1 in 5 americans either has had bed bugs or knows someone who has and the problem isnt going away its actually getting a lot worsehosted by: michael aranda----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporters -- we couldn039t make scishow without them shout out to james harshaw kevin bealer mark terrio-cameron patrick merrithew accalia elementia charles southerland fatima iqbal benny kyle anderson tim curwick will and sonja marple philippe von bergen bryce daifuku chris peters kathy philip patrick d ashmore charles george bader alghamdi----------like scishow want to help support us and also get things to put on your walls cover your torso and hold your liquids check out our awesome products over at dftba records: http:dftbacomscishow----------looking for scishow elsewhere on the internetfacebook: http:wwwfacebookcomscishowtwitter: http:wwwtwitterc |
|
how do noise-canceling headphones work
Bookmarked 503 weeks ago youre on a flight and the drone of the engines is getting on your nerves so you pop on a pair of noise-canceling headphones and sweet blessed silence descends but those headphones arent just muffling the sound -- theyre actually making it go awayhosted by: michael aranda----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporters -- we couldn039t make scishow without them shout out to justin ove andreas heydeck justin lentz will and sonja marple benny chris peters tim curwick philippe von bergen patrick fatima iqbal lucy mcglasson mark terrio-cameron accalia elementia kathy amp tim philip charles george kevin bealer thomas j and patrick d ashmore----------like scishow want to help support us and also get things to put on your walls cover your torso and hold your liquids check out our awesome products over at dftba records: http:dftbacomscishow----------looki |
|
air conditioners: coolest idea ever
Bookmarked 502 weeks ago all humans want to be comfy but the first air conditioner wasn039t built for us--it was for a printing press this video was made in collaboration with amp sponsored by http:wwwemersoncomilovestemhosted by: hank green----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporters -- we couldn039t make scishow without them shout out to justin ove andreas heydeck justin lentz will and sonja marple benny chris peters tim curwick philippe von bergen patrick fatima iqbal lucy mcglasson mark terrio-cameron accalia elementia kathy amp tim philip charles george kevin bealer thomas j and patrick d ashmore----------like scishow want to help support us and also get things to put on your walls cover your torso and hold your liquids check out our awesome products over at dftba records: http:dftbacomscishow----------looking for scishow elsewhere on the internetfacebook: http: |
|
the adventures of indiana jones by patrick schoenmaker
Bookmarked 489 weeks ago famous archaeologist dr indiana jones is on a quest of a lifetime but this time he is fully animated in this passion project by life long fan and artist patrick schoenmaker over the course of 5 years he has crafted the opening sequence of what would be the tv series to make all other tv shows redundant: quotthe adventures of indiana jonesquot enjoy and if you liked it please share leave a comment and subscribe to our youtube channelvisit the artists website: http:wwwpatrickschoenmakercom |
|
how a sick chimp led to a global pandemic: the rise of hiv
Bookmarked 428 weeks ago in the first video in our two part series on hiv and aids we explain how scientists figured out what hiv is when the infection morphs into aids and where they think the virus originatedwe039re conducting a survey of our viewers if you have time please give us feedback: https:wwwsurveymonkeycomrscishowsurvey2017hosted by: michael aranda----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporters: ksam lutfi kevin knupp nicholas smith inerri da noe alexander wadsworth piya shedden katiemarie magnone scott satovsky jr bella nash charles southerland bader alghamdi james harshaw patrick merrithew patrick d ashmore candy tim curwick charles george saul mark terrio-cameron viraansh bhanushali kevin bealer philippe von bergen chris peters fatima iqbal justin lentz----------looking for scishow elsewhere on the internetfacebook: http:wwwfaceb |
|
what the crispr embryo editing study really taught us
Bookmarked 444 weeks ago what did the recent study using the crispr gene editing technique actually entail and what did we learn from ithosted by: hank green----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporters: kevin bealer mark terrio-cameron katiemarie magnone patrick merrithew da noe charles southerland fatima iqbal sultan alkhulaifi nicholas smith tim curwick alexander wadsworth scott satovsky jr philippe von bergen bella nash chris peters patrick d ashmore piya shedden charles george----------looking for scishow elsewhere on the internetfacebook: http:wwwfacebookcomscishowtwitter: http:wwwtwittercomscishowtumblr: http:scishowtumblrcominstagram: http:instagramcomthescishow----------sources:https:wwwnaturecomnaturejournalvaopncurrentpdfnature23305pdfhttps:wwwnaturecomnaturejournalvaopncurrentfullnature23533htmlhttp:wwwnaturecomnewscrispr-fixes- |
|
power039s 039tariq st patrick039 gets donkey of the day
Bookmarked 443 weeks ago power039s 039tariq st patrick039 gets donkey of the day check out what charlamagne had to say listen live: http:power1051fmcom facebook: https:wwwfacebookcompower1051ny twitter: https:twittercompower1051 instagram: https:wwwinstagramcompower1051 |
|
why do we get nosebleeds
Bookmarked 440 weeks ago one moment you039re fine the next moment it seems like your nose is recreating a scene from the shining why do we get nosebleedshosted by: hank green----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporters: kevin bealer mark terrio-cameron katiemarie magnone patrick merrithew da noe charles southerland fatima iqbal sultan alkhulaifi nicholas smith tim curwick alexander wadsworth scott satovsky jr philippe von bergen bella nash chris peters patrick d ashmore piya shedden charles george----------looking for scishow elsewhere on the internetfacebook: http:wwwfacebookcomscishowtwitter: http:wwwtwittercomscishowtumblr: http:scishowtumblrcominstagram: http:instagramcomthescishow----------sources:http:wwwuofmhealthorghealth-librarynosbdhttps:wwwncbinlmnihgovbooksnbk435997http:wwwaafporgafp20050115p305htmlsec-2http:careamerican |
|
what do dogs see when they watch tv
Bookmarked 422 weeks ago some dogs just seem to love watching tv but are they really watching what we see we039re conducting a survey of our viewers if you have time please give us feedback: https:wwwsurveymonkeycomrscishowsurvey2017hosted by: hank green----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporters: kelly landrum jones sam lutfi kevin knupp nicholas smith da noe alexander wadsworth piya shedden katiemarie magnone scott satovsky jr bella nash charles southerland bader alghamdi james harshaw patrick merrithew patrick d ashmore candy tim curwick charles george saul mark terrio-cameron viraansh bhanushali kevin bealer philippe von bergen chris peters justin lentz----------looking for scishow elsewhere on the internetfacebook: http:wwwfacebookcomscishowtwitter: http:wwwtwittercomscishowtumblr: http:scishowtumblrcominstagram: http:insta |
|
how quotflying deathquot has saved hundreds of lives
Bookmarked 452 weeks ago curare known as quotflying deathquot was used for centuries to make poisoned arrows scientists discovered how to use it to create life saving medical treatments that we still use todayhosted by: michael aranda----------support scishow by becoming a patron on patreon: https:wwwpatreoncomscishow----------dooblydoo thanks go to the following patreon supporterswe couldn039t make scishow without them shoutout to kevin bealer mark terrio-cameron katiemarie magnone patrick merrithew charles southerland fatima iqbal sultan alkhulaifi tim curwick scott satovsky jr philippe von bergen bella nash chris peters patrick d ashmore piya shedden charles george----------looking for scishow elsewhere on the internetfacebook: http:wwwfacebookcomscishowtwitter: http:wwwtwittercomscishowtumblr: http:scishowtumblrcominstagram: http:instagramcomthescishow----------sources:http:onlinelibrarywileycomdoi101038sjbjp0706404abstracthttp:wwwsciencedirectc |















