Tag results for wendover
sort by: relevance | recent
Results from VideoSift (3 out of 16)
|
the world039s shortcut: how the panama canal works
Bookmarked 353 weeks ago by videosift learn with brilliant for 20 off by being one of the first 200 to sign up at http:brilliantorgwendoverlisten to extremities at http:extremitiespodcastc |
|
the deadly logistics of climbing everest
Bookmarked 384 weeks ago by videosift stay safe online with dashlane by signing up at http:dashlanecomwendoverto get 10 off upgrading to premium use the code wendover at checkoutsubscribe |
|
how africa is becoming china039s china
Bookmarked 401 weeks ago by videosift start learning with brilliant for free at http:brilliantorgwendoverthe first 200 to sign up for a premium account with that link will also get 20 offc |
Results from all user's collections (83 out of ~83)

The results from your search appear low, try our web search for better results.
|
the secretive company that supplies the worlds fast food - youtube
Bookmarked 224 weeks ago is it surprising one company makes the food for almost every restaurant kfc starbucks pizza hut chipolte macdonald impossible foods burger king and moreosi |
|
the insane logistics of shutting down the cruise industry - youtube
Bookmarked 261 weeks ago sign up for a curiositystream subscription and also get a free nebula subscription the streaming platform built by creators here: http:curiositystreamco |
|
how covid-19 broke the airline pricing model - youtube
Bookmarked 293 weeks ago learn complex topics simply by being one of the first 200 to sign up at http:brilliantorgwendover listen to extremities at http:extremitiespodcastcom |
|
the five rules of risk
Bookmarked 307 weeks ago get your custom domain or email for 10 off at http:hovercomwendoverlisten to extremities at http:extremitiespodcastcombuy a wendover productions t-shirt: https:standardtvcollectionswendover-productionsproductswendover-productions-shirtsubscribe to half as interesting the other channel from wendover productions: https:wwwyoutubecomhalfasinterestingyoutube: http:wwwyoutubecomwendoverproductionsinstagram: http:instagramcomsamfromwendovertwitter: http:wwwtwittercomwendoverprosponsorship enquiries: wendoverstandardtvother emails: samwendoverproductionsreddit: http:redditcomrwendoverproductionsanimation by josh sherringtonsound by graham haerther http:wwwhaerthernetthumbnail by simon buckmastermusic by http:epidemicsoundcomselect footage courtesy the ap archivereferences:1 https:wwwcdcgovmotorvehiclesafetypedestrian_safetyindexhtml2 https:wwwstatistacomstatistics198029total-number-of-us-licensed-drivers-by-state3 |
|
air cargo039s coronavirus problem
Bookmarked 310 weeks ago sign up for an annual curiositystream subscription and also get a free nebula subscription the new streaming platform built by creators here: http:curiositystreamcomwendoverlisten to extremities at http:extremitiespodcastcombuy a wendover productions t-shirt: https:standardtvcollectionswendover-productionsproductswendover-productions-shirtsubscribe to half as interesting the other channel from wendover productions: https:wwwyoutubecomhalfasinterestingyoutube: http:wwwyoutubecomwendoverproductionsinstagram: http:instagramcomsamfromwendovertwitter: http:wwwtwittercomwendoverprosponsorship enquiries: wendoverstandardtvother emails: samwendoverproductionsreddit: http:redditcomrwendoverproductionsanimation by josh sherringtonsound by graham haerther http:wwwhaerthernetthumbnail by simon buckmastermusic by http:epidemicsoundcomselect footage courtesy the ap archivereferences:1 https:twittercomeurocontroldgstatus12546836730745856 |
|
how offshore oil rigs work
Bookmarked 312 weeks ago get a free audiobook plus unlimited audible originals for free by signing up at http:audiblecomwendover or by texting wendover to 500-500listen to extremities at http:extremitiespodcastcombuy a wendover productions t-shirt: https:standardtvcollectionswendover-productionsproductswendover-productions-shirtsubscribe to half as interesting the other channel from wendover productions: https:wwwyoutubecomhalfasinterestingyoutube: http:wwwyoutubecomwendoverproductionsinstagram: http:instagramcomsamfromwendovertwitter: http:wwwtwittercomwendoverprosponsorship enquiries: wendoverstandardtvother emails: samwendoverproductionsreddit: http:redditcomrwendoverproductionsanimation by josh sherringtonsound by graham haerther http:wwwhaerthernetthumbnail by simon buckmastermusic by http:epidemicsoundcomselect footage courtesy the ap archivereferences:1 https:wwwrystadenergycomglobalassetsproductsep-solutionsucubecost-of-supply-oil-g |
|
how the us039 hospital ships work
Bookmarked 314 weeks ago learn with skillshare for free for two months by being one of the first 1000 to sign up at http:sklshwendover9listen to extremities at http:extremitiespodcastcombuy a wendover productions t-shirt: https:standardtvcollectionswendover-productionsproductswendover-productions-shirtsubscribe to half as interesting the other channel from wendover productions: https:wwwyoutubecomhalfasinterestingyoutube: http:wwwyoutubecomwendoverproductionsinstagram: http:instagramcomsamfromwendovertwitter: http:wwwtwittercomwendoverprosponsorship enquiries: wendoverstandardtvother emails: samwendoverproductionsreddit: http:redditcomrwendoverproductionsanimation by josh sherringtonsound by graham haerther http:wwwhaerthernetthumbnail by simon buckmastermusic by http:epidemicsoundcomselect footage courtesy the ap archivereferences:1 https:ihl-databasesicrcorgapplicihlihlnsfcommentxspaction=opendocumentampdocumentid=1e5a1f4d6dbd9a08c1258115003c8b |
|
how china built a hospital in 10 days
Bookmarked 322 weeks ago sign up for an annual curiositystream subscription and also get a free nebula subscription the new streaming platform built by creators here: http:curiositystreamcomwendoverlisten to extremities at http:extremitiespodcastcombuy a wendover productions t-shirt: https:standardtvcollectionswendover-productionsproductswendover-productions-shirtsubscribe to half as interesting the other channel from wendover productions: https:wwwyoutubecomhalfasinterestingyoutube: http:wwwyoutubecomwendoverproductionsinstagram: http:instagramcomsamfromwendovertwitter: http:wwwtwittercomwendoverprosponsorship enquiries: wendoverstandardtvother emails: samwendoverproductionsreddit: http:redditcomrwendoverproductionsanimation by josh sherringtonsound by graham haerther http:wwwhaerthernetthumbnail by simon buckmastermusic by http:epidemicsoundcomselect footage courtesy the ap archiveselect footage courtesy and under creat |
|
amtraks grand plan for profitability
Bookmarked 332 weeks ago get the perfect suitcase for 20 off by going to http:awaytravelcomwendover20 and using the promo code wendover20listen to extremities at http:extremitiespodcastcombuy a wendover productions t-shirt: https:standardtvcollectionswendover-productionsproductswendover-productions-shirtsubscribe to half as interesting the other channel from wendover productions: https:wwwyoutubecomhalfasinterestingyoutube: http:wwwyoutubecomwendoverproductionsinstagram: http:instagramcomsamfromwendovertwitter: http:wwwtwittercomwendoverprosponsorship enquiries: wendoverstandardtvother emails: samwendoverproductionsreddit: http:redditcomrwendoverproductionsanimation by josh sherringtonsound by graham haerther http:wwwhaerthernetthumbnail by simon buckmastermusic by http:epidemicsoundcomselect footage courtesy the ap archiveunsw photo courtesy sardaka university of sydney photo courtesy jason tongreferences:1 https:skiftcom20161011delta-air-li |
|
why so many airlines are going bankrupt
Bookmarked 339 weeks ago start building your online store with shopify for free for 14 days by signing up at http:shopifycomwendoverbuy a wendover productions t-shirt from our shopify-powered store: https:standardtvcollectionswendover-productionsproductswendover-productions-shirtlisten to extremities at http:extremitiespodcastcomsubscribe to half as interesting the other channel from wendover productions: https:wwwyoutubecomhalfasinterestingyoutube: http:wwwyoutubecomwendoverproductionsinstagram: http:instagramcomsamfromwendovertwitter: http:wwwtwittercomwendoverprosponsorship enquiries: wendoverstandardtvother emails: samwendoverproductionsreddit: http:redditcomrwendoverproductionsanimation by josh sherringtonsound by graham haerther http:wwwhaerthernetthumbnail by simon buckmastermusic by http:epidemicsoundcomselect footage courtesy the ap archivereferences:1 https:wwwairlinesiataorgnewsiata-forecasts-355bn-net-profit-for-airlines-in-20192 htt |
|
cities at sea: how aircraft carriers work
Bookmarked 347 weeks ago sign up for free at http:brilliantorgwendoverthe first 200 to use that link will also get 20 off their annual premium subscriptionsubscribe to half as interesting the other channel from wendover productions: https:wwwyoutubecomhalfasinterestingget the wendover productions t-shirt: https:standardtvcollectionswendover-productionsproductswendover-productions-shirtcheck out my personal channel: https:wwwyoutubecomchannelucda1x6rrhzzqohogvc3kswgsupport wendover productions on patreon: https:wwwpatreoncomwendoverproductionsyoutube: http:wwwyoutubecomwendoverproductionsinstagram: http:instagramcomwendoverproductionstwitter: http:wwwtwittercomwendoverproemail: samwendoverproductionsreddit: http:redditcomrwendoverproductionsreferences:1 https:scienceblogscomgregladen20111018how-many-people-live-near-the2 https:webarchiveorgweb20180906195559http:wwwnvrnavymilshipdetailsshipsdetail_cvn_68_5151html3 https:wwwglobalsecu |
|
the nfl039s logistics problem
Bookmarked 350 weeks ago learn from over 25000 classes for free for two months by signing up at http:sklshwendover6listen to extremities at http:extremitiespodcastcomsubscribe to half as interesting the other channel from wendover productions: https:wwwyoutubecomhalfasinterestingget the wendover productions t-shirt: https:standardtvcollectionswendover-productionsproductswendover-productions-shirtsupport wendover productions on patreon: https:wwwpatreoncomwendoverproductionsyoutube: http:wwwyoutubecomwendoverproductionsinstagram: http:instagramcomsamfromwendovertwitter: http:wwwtwittercomwendoverprosponsorship enquiries: wendoverstandardtvother emails: samwendoverproductionsreddit: http:redditcomrwendoverproductionsanimation by vincent de langensound by graham haerther http:wwwhaerthernetthumbnail by simon buckmasterspecial thanks to patreon supporters adam chelminski arkadiy kulev charles zilinski chris allen connor j smith daddy donald etienne decha |
|
the world039s shortcut: how the panama canal works
Bookmarked 353 weeks ago learn with brilliant for 20 off by being one of the first 200 to sign up at http:brilliantorgwendoverlisten to extremities at http:extremitiespodcastcomsubscribe to half as interesting the other channel from wendover productions: https:wwwyoutubecomhalfasinterestingget the wendover productions t-shirt: https:standardtvcollectionswendover-productionsproductswendover-productions-shirtsupport wendover productions on patreon: https:wwwpatreoncomwendoverproductionsyoutube: http:wwwyoutubecomwendoverproductionsinstagram: http:instagramcomsamfromwendovertwitter: http:wwwtwittercomwendoverproemail: samwendoverproductionsreddit: http:redditcomrwendoverproductionsanimation by josh sherrington sound by graham haerther http:wwwhaerthernetthumbnail by simon buckmasterspecial thanks to patreon supporters adam chelminski arkadiy kulev charles zilinski chris allen connor j smith daddy donald etienne dechamps eyal matsliah hank green john am |
|
how airlines decide where to fly
Bookmarked 366 weeks ago watch over 2000 documentaries for free for 30 days by signing up at http:curiositystreamcomwendover and using the code wendover at checkoutsubscribe to half as interesting the other channel from wendover productions: https:wwwyoutubecomhalfasinterestingget the wendover productions t-shirt: https:standardtvcollectionswendover-productionsproductswendover-productions-shirtsupport wendover productions on patreon: https:wwwpatreoncomwendoverproductionsyoutube: http:wwwyoutubecomwendoverproductionsinstagram: http:instagramcomsamfromwendovertwitter: http:wwwtwittercomwendoverproemail: samwendoverproductionsreddit: http:redditcomrwendoverproductionsanimation by josh sherrington sound by graham haerther http:wwwhaerthernetthumbnail by simon buckmasterspecial thanks to patreon supporters alec m watson andrew j thom arkadiy kulev chris allen chris barker connor j smith daddy donald etienne dechamps eyal matsliah hank green harrison w |
|
the deadly logistics of climbing everest
Bookmarked 384 weeks ago stay safe online with dashlane by signing up at http:dashlanecomwendoverto get 10 off upgrading to premium use the code wendover at checkoutsubscribe to half as interesting the other channel from wendover productions: https:wwwyoutubecomhalfasinterestingget the wendover productions t-shirt: https:standardtvcollectionswendover-productionsproductswendover-productions-shirtcheck out my personal channel: https:wwwyoutubecomchannelucda1x6rrhzzqohogvc3kswgsupport wendover productions on patreon: https:wwwpatreoncomwendoverproductionsyoutube: http:wwwyoutubecomwendoverproductionstwitter: http:wwwtwittercomwendoverproemail: samwendoverproductionsreddit: http:redditcomrwendoverproductionsfootage of climbing base camp oxygen helicopter and everests summit is taken from dr melanie windridges science of the summit video series for the institute of physics the full series can be viewed here: http:bitlyeverestvidsreferences:1 https:w |
< prev |







