Tag results for carrots
sort by: relevance | recent
Results from Reddit Videos (3 out of 8)
|
honey roasted carrots - you suck at cooking episode 75
Bookmarked 410 weeks ago by reddit carrots they039re dangerously delicioussubscribe: http:bitly1huynlyhttps:twittercomyousuckatcookinsnapchat: yousuckatcookin http:instagramcomyousucka |
|
cthulhu vs the sith or the carrot monster revenge
Bookmarked 754 weeks ago by reddit a stop motion animation we made with our kids the music was written coded in matlab so sorry for the weirdness = |
|
dave chappelle - weed conversations
Bookmarked 767 weeks ago by reddit dave chappelle - weed conversations for what it039s worth |
Results from all user's collections (42 out of ~42)
The results from your search appear low, try our web search for better results.
|
health benefit compounds of black carrots
Bookmarked 367 weeks ago the bodys immune system is built against harmful cancer cells by the component found in black carrotshttp:bitly2gfqe8v moreover the antioxidative properties of black carrots you to get rid of free radicals and thus neutralizes the cancerous activities in your body |
|
dog vs flying carrots: funny dog maymo
Bookmarked 573 weeks ago dog vs flying carrots: funny dog maymoto use this video in a commercial player advertising or in broadcasts email viral spiral contactviralspiralgroupcomsubscribe http:bitlyvzyuvemaymo039s instagram: http:googl1mrhrhmaymo039s facebook: http:onfbmeupc8d7maymo039s twitter: http:bitlywk4dxxcute dog maymo loves carrots so he is extremely excited when he walks into the dining room to find 5 carrots swinging from the ceiling fan watch this funny dog jump and swat at the carrots trying to catch them in his mouth as they whirl around in the air maymo039s lip-smacking sounds throughout the video will kill you with cuteness |
|
cute hamster stuffs face full of carrots - video
Bookmarked 619 weeks ago how many party sized carrots can this pint sized hamster fit into his chubby cheeks |
|
food theory: but really do carrots help your eyes - youtube
Bookmarked 215 weeks ago subscribe for your weekly dose of food theory https:bitly2cdcoov theorists have you ever heard the saying that eating more carrots will help make y |
|
|
honey roasted carrots - you suck at cooking episode 75
Bookmarked 410 weeks ago carrots they039re dangerously delicioussubscribe: http:bitly1huynlyhttps:twittercomyousuckatcookinsnapchat: yousuckatcookin http:instagramcomyousuckatcookinghttp:facebookcomyousuckatcookingto make these carrots:get some carrots get the other stuff drizzle some olive oil honey pepper pepper pepper and salt on the carrots cross rassle and side rassle them until covered bake for 25 minutes on 4 hundo be careful |
|
sauteed mixed vegetables - youtube
Bookmarked 208 weeks ago as they say it is good to incorporate vegetables into your meal we all need protein but a side of vegetables would be a great combination to complete a heal |
|
do carrots help you see better - reactions
Bookmarked 586 weeks ago you heard it from your mom over and over again quoteat your carrots they039ll help you see betterquot so is it true we teamed up with chemist chad jones host of the collapsed wavefunction podcast to crack the carrot case wide opencheck out chad039s podcast and blog here: http:wwwthecollapsedwavefunctioncomand find us in all of these places:subscribe http:bitlyacsreactionsfacebook http:facebookcomacsreactionstwitter http:twittercomacsreactionsscientific consultant: chad jones phdwords: noel waghorn and chad jonesvideo: elaine seward |
|
|
cthulhu vs the sith or the carrot monster revenge
Bookmarked 754 weeks ago a stop motion animation we made with our kids the music was written coded in matlab so sorry for the weirdness = |
|
i like vegetables -- parry gripp
Bookmarked 772 weeks ago rock that cabbagemusic by parry gripp:http:parrygrippcom |
|
sandy kenyon reviews carrots
Bookmarked 789 weeks ago quotusing a ladle to pour ranch dressing into my mouth would be weird so i just triple-dip a carrot insteadquotsandy kenyon the guy who does movie reviews on taxitv is reviewing the entire world this time he critiques everyone039s favorite food: carrots two thumbs upfor more reviews visit:http:wwwsandykenyonreviewstheworldcom |
|
|
casey veggies - sleeping in class: deluxe edition 92011
Bookmarked 755 weeks ago sleeping in class deluxe drops 92011 on itunes and amazon will be released on physical ampamp vinyl shortly after love filmed ampamp edited by vimeocompatricklawlerwwwcaseyveggiescom |
|
half a ton of weed found hidden in coconuts
Bookmarked 512 weeks ago if your weed man tells you he doesn039t have any tree for you then it039s probably because customs officials just seized half a ton of weed hidden in coconuts at the us-mexico border |
|
casey veggies - ridin039 roun town
Bookmarked 793 weeks ago track 2 on sleeping in classdirected by: jeromedcom wwwcaseyveggiescomwwwtwittercomcaseyveggies |
|
carrots potatoes and zombies snapshot 12w34a part 1
Bookmarked 705 weeks ago lewis and simon mess around with the latest changes to minecraft many thanks to the voxelbox guys for sorting this out - check their behind-the-scenes video here: http:wwwyoutubecomwatchv=by40nnywjfgchange log: http:wwwredditcomrminecraftcommentsyp59712w34a_snapshot_is_accessible_now yogscast gear: http:yogscastspreadshirtcouk facebook: http:wwwfacebookcomyogscast twitter: http:wwwtwittercomyogscast forums: http:yogscastcomforumphp podcast: http:itunesapplecomgbpodcastthe-yogpodid304557271 powered by chillblast: http:wwwchillblastcomyogscasthtml po box: the yogscast po box 3125 bristol bs2 2dg |
< prev |