Tag results for hiv
sort by: relevance | recent
Results from Favorites (1 out of 1)
|
hot rod talks about hisassinjectionshiv trapboyyampampampampampampamppreferringwhitetops
Bookmarked 690 weeks ago by ouch4000 teamhotrod paw power |
Results from all user's collections (285 out of ~285)
|
living with hiv amp aids: bitter hiv positive people spreading hiv
Bookmarked 649 weeks ago frankphillytv talking about bitter people living with hiv or have aids and how they have unprotected sex and spread hiv to people who are hiv negative wrap it up and get a hiv test done folks and people who are hiv positive seek counseling there039s alot of support groups out their for people who are hiv people or living with aids |
|
living with hiv
Bookmarked 698 weeks ago watch the latest breaking news politics entertainment and offbeat videos everyone is talking about at cnncomget informed now |
|
home hiv test could soon be available
Bookmarked 726 weeks ago watch the latest breaking news politics entertainment and offbeat videos everyone is talking about at cnncomget informed now |
|
antibody neutralizes 91 of hiv strains strong step towards a vaccine
Bookmarked 821 weeks ago will hiv eventually go the way of smallpox and polio earlier this month scientists at thenational institute of health nihannounced their discovery |
|
teen039s hiv remission a mystery
Bookmarked 561 weeks ago a french teenager infected at birth with hiv has shown the ability to control levels of the infection in her body -- without being on antiretroviral treatment |
|
battling hiv in lesotho - video library - the new york times
Bookmarked 785 weeks ago dr paul young an american pediatric hiv specialist is highly prized in a country with the world |
|
family with hiv 039treated like monsters039
Bookmarked 697 weeks ago watch the latest breaking news politics entertainment and offbeat videos everyone is talking about at cnncomget informed now |
|
hiv positive dating
Bookmarked 625 weeks ago are you living with hivhiv can really complicate your dating lifethat039s where hiv-positive dating can help youconnect with others who are hiv positivefrom finding new friends to discovering a new romantic interestyou039ll meet lots of wonderful people on wwwhiv-positive datingcomcreate a free profile today |
|
hiv calculator
Bookmarked 636 weeks ago http:wwwhivcalculatorcom - find your odds of getting hiv using hiv risk calculator use the hiv risk quiz to determine whether you should take an hiv test the risk quiz will help you determine whether hiv risk factors are applicable to you and what you should do if they are |
|
hiv positive dating sites
Bookmarked 357 weeks ago visit us wwwhivpositivedatingsitesorgltbrgta private and comfortable place to meet someone in the same boat for support date and love |
|
hiv singles dating ups and downs of internet dating
Bookmarked 350 weeks ago click link to find partner: wwwhivpositivedatingsitesorgltbrgthiv positive friends dating community where you are living with hiv stds or herpes join us to look for friends and you are not alone 100 safe |
|
did you searched many hiv dating sites that didn039t suites you - youtube
Bookmarked 289 weeks ago join free: https:wwwhivpositivedatingsitesorg we are here with good news for people suffering from hiv there is no need for you to lock yourself down i |
|
hiv cure hiv treatment free hiv reiki course free lifetime treatment
Bookmarked 399 weeks ago subscribe us: https:bitly2mtwsn6free hiv aids reiki course: https:bitly2o1tupzfor treatment visit facebook: https:wwwfacebookcomhivaidsreikiour website: https:grandmasterroseblogspotcom |
|
meet hiv singles - why do you need to join hivpositivedatingsitesorg - youtube
Bookmarked 300 weeks ago join free: https:wwwhivpositivedatingsitesorg hiv is growing day by day and by now many people have been affected by this virus but instead of fighting |
|
long term relationship advice hiv singes dating
Bookmarked 348 weeks ago make a match right now: wwwhivpositivedatingsitesorgltbrgtmeet positive singles with hsv and herpes to find love and support join to meet people with positive singles now100 anonymous and safe |
< prev |












