collect the videos you love
collect | share | explore
Tag results for tanks
sort by: relevance | recent
Results from all user's collections (117 out of ~117)
liveleakcom - victory day in mariupol ukraine people vs tanks

victory day over fascism in mariupol ukraine civilians against tanks trying to stop victory day celebrations may 9th 2014
fuel storage tanks for farms

the nature of your fuel is just on a par with within your fuel storage tanks for farms fuel tanks regularly rot from the back to front at the point when this occurs dregs and other free particles can advance into your vehicles and hardware and influence their execution
fuel storage tanks for sale

fuel storage tank http:containersinmotioncomshowroomother-containersitem8-fuel-storage-tanks compound oxidation makes particulate stores or residue the rate of fuel corruption in expanded capacity isn039t unsurprising and shifts by capacity structure area natural issues and so on moreover water development can consume tank metals making slime a perfect development mechanism for microorganisms bacterial organisms or yeast
how to connect nitrous tanks with whip cream dispenser

whip cream dispenser can be adapted to 8g and 580g products of course it is more convenient to connect large-capacity tanks but more attention should be paid to safe operation in use for more information please visit our page: https:greatwhipscom or know any more details watch our video on youtube: https:wwwyoutubecomwatchv=tizh5vbjjm4
how russiarsquos strategy in ukraine failed not the tank - youtube

russian forces lost a vast numbers of tanks during the first few months of the war prompting questions over whether they were becoming obsoletesubscribe to
liveleakcom - russia: first delivery of russian t-72 tanks arrive in crimea

russian t-72 b-3 tanks arrived by rail monday at the ostryakovo rail station near simferopol the first delivery of russian military hardware to the region deputy defence minister dmitry bulgakov tol
water tanks for sale

liquid containment is a one-stop destination which provides water tanks for sale we are known for providing water tanks of all the shapes and sizes to cater to all your needs moreover we never compromise on our quality to know more about us pay a visit to our website http:wwwliquidcontainmentcomau
rain water tanks rainwater harvesting tanks from greening-solutioncom

i like my business cooperation with leiyuan company although we came across some problems they gave their ideas and explain in details which help me a lot and more than what i expected what we need is not only the products but also after-sale service such as the instruction they are the very good business partners url: http:wwwgreening-solutioncomrainwater-harvesting-tanks
why warplane fuel tanks make great hot rods

built from the discarded fuel tanks of wwii fighter planes quotbelly tankersquot are miniature speed demons and a major part of hot rod culturefor more check out: https:wwwpetersenorg1952-so-cal-speed-shop-special-belly-tank-racermore cars content:driving from a couch on the roof like mr beanhttps:wwwyoutubecomwatchv=bhsegvuxufkhow this 3-wheeled car saved an entire aerospace companyhttps:wwwyoutubecomwatchv=i2ixwr11n9wstretch van feels like a private jethttps:wwwyoutubecomwatchv=i4sw00ql_fk------------------------------------------------------warplane hotrod businessinsiderbusiness insider tells you all you need to know about business finance tech retail and moresubscribe to our channel and visit us at: https:readbi7xquhibi on facebook: https:readbi2xocecjbi on instagram: https:readbi2q2d29tbi on twitter: https:readbi2xcnzgfbi on amazon prime: http:readbiprimevideo--------------------------------------------------why warplan
ukraine crisis 2014 - slovyansk tanks go into town may 31 2014

ukraine crisis 2014 slovyansk tanks go into townukraine war 2014 slovyansk tanks go into townukraine crisis 2014 slovyansk tanks go into town may 31 2014video http:youtubeyoxmcgsjltqdon039t readukraine war 2014 ukraine news ukraine today ukraine crisis ukraine referendum ukraine revolution ukraine army attack ukraine military attack ukraine shooting pro-moscow separatists ukraine tension ukraine today ukraine battle ukraine war ukraine armed ukraine tank ukraine air force ukraine jet tank ukraine vs separatist ukraine military ukraine war 2014 ukraine vs russia ukraine russia ukraine military power 2014 ukraine military base mobilization ukraine army ukraine army 2014 ukraine crisis donetsk odessa slaviansk sloviansk kiev euromaidan separatist militan militia pro-russia terorrist russia ukraine russia vs ukraine ukraine got talent 2014 ukraine russia war 2014 ukraine news ukraine update ukraine tension ukraine riots ukraine referendum ukraine revolution ukraine military ukraine war 2014 ukraine vs russia ukraine russia ukraine military power 2014 ukraine military base mobilization ukraine army ukraine army 2014 ukraine crisis donetsk odessa slaviansk sloviansk kiev russia today ukraine separatist ukraine raw militan militia pro-russia terorrist russia ukraine russia vs ukraine ukraine got talent 2014 ukraine russia war 2014 ukraine news ukraine update ukraine tension ukraine riots ukraine referendum ukraine revolution raw footage video full video footage 2014 - 2014 2014 2014 2014 euromaidan militan - terorrist 2014
ukraine war 2014 tanks and armored vehicles in makeevka june 11 2014

ukraine war 2014 tanks and armored vehicles in makeevkaukraine war 2014 tanks and armored vehicles in makeevkaukraine war 2014 tanks and armored vehicles in makeevkavideo http:youtube2mwhaacevcytanks and armored vehicles in makeevkatanks and armored vehicles in makeevkatanks and armored vehicles in makeevkatoday a column of russian tanks that illegally crossed the ukrainian border during the night appeared in the center of makiyivkadon039t readukraine war 2014 ukraine news ukraine today ukraine crisis ukraine referendum ukraine revolution ukraine army attack ukraine military attack ukraine shooting pro-moscow separatists ukraine tension ukraine today ukraine battle ukraine war ukraine armed ukraine tank ukraine air force ukraine jet tank ukraine vs separatist ukraine military ukraine war 2014 ukraine vs russia ukraine russia ukraine military power 2014 ukraine military base mobilization ukraine army ukraine army 2014 ukraine crisis donetsk odessa slaviansk sloviansk kiev euromaidan separatist militan militia pro-russia terorrist russia ukraine russia vs ukraine ukraine got talent 2014 ukraine russia war 2014 ukraine news ukraine update ukraine tension ukraine riots ukraine referendum ukraine revolution ukraine military ukraine war 2014 ukraine vs russia ukraine russia ukraine military power 2014 ukraine military base mobilization ukraine army ukraine army 2014 ukraine crisis donetsk odessa slaviansk sloviansk kiev russia today ukraine separatist ukraine raw militan militia pro-russia terorrist russia ukraine russia vs ukraine ukraine got talent 2014 ukraine russia war 2014 ukraine news ukraine update ukraine tension ukraine riots ukraine referendum ukraine revolution raw footage video full video footage 2014 - 2014 2014 2014 2014 euromaidan militan - terorrist 2014
production tank suppliers

http:wwwafctankscom - are you looking for a production tank for your next big project this video highlights just a few of the benefits of choosing afc production tank suppliers for your industry our personnel have 50 years of experience of both engineering and manufacturing in this field as a result we are aware that each industry and each project has specific needs and requirements to get the job done right our production tank suppliers offer a variety of different tank specifications you can choose from this way you can create a customized production tank that works for you have a large tank to which you need easy access no problem afcs production tank suppliers can include both staircases and ladders to your new tank whether we are adding new features to your existing tank or are designing a new tank from scratch our manufacturers are committed to quality our goal is to provide you with a reliable tank that works right the first time each of our tanks is made of high-quality materials and is offered to you at an affordable price for more information about how our production tank suppliers can help you fulfill your project goals visit our website
world of tanks review - honest review of world of tanks

world of tanks review click the link bellow to get your world of tanks now http:googluioppthear the title see a few screenshots and you could be forgiven for assuming that world of tanks is a simulation game inaccessible to anyone who doesn039t know the difference between a t20 and a t29 that039s not the case at all though world of tanks is a shooter first and foremost with uncomplicated controls and a relatively sedate pace that make it easy to get into furthermore it039s a free-to-play game that while loaded with plenty of ways for you to spend money can be enjoyed for countless hours without ever doing so world of tanks wouldn039t be difficult to recommend even if reaching for your wallet was a prerequisite so recommending that you give it a try for free is a no-brainer when you039re not in the mood to play as artillery you can choose to drive either a regular tank or a tank destroyer the choice might seem obvious given the names but while tank destroyers undoubtedly hit hard enough to live up to their name they also don039t have nearly as much armor as tanks if an enemy gets behind you or manages to attack you from the side you039re going to take a lot of damage so when driving a tank destroyer you need to think about staying unseen which might mean equipping a camo net andor remaining still for extended periods of time the biggest disadvantage that the vast majority of tank destroyers have versus tanks is that their guns are fixed rather than mounted on turrets so the only way to target an enemy off to one side of you is to turn your entire vehicle around that can be a painfully slow process and it can also make you visible to enemies who otherwise might not have had any idea that you were nearby driving a tank destroyer is perhaps the most challenging way to play world of tanks but it can also be the most satisfying in a tank destroyer you039re powerful enough to defend your base long after most of your teammates have been killed and fast enough to then make a dash for the enemies039 base if you039d rather win by capturing it than by completely eradicating the oppositionhttp:youtubeekxxeujebdkregular light medium and heavy tanks come in dozens more flavors than artillery and tank destroyers do and your role on the battlefield is at least partly determined by the capabilities of your vehicle fast lightweight tanks make great scouts while powerful tanks that take multiple minutes to get across a map are better suited to defense--at least early in a match your role often changes as a game plays out there are no respawns in world of tanks so there039s not much point trying to play as a scout if all of your team039s artillery has already been destroyed for example there039s only one game mode but no two battles ever play out the same way and since you039re forced to choose your vehicle before you know which map you039re going to be fighting on you frequently have to contend with geography that works against you some maps incorporate or are set entirely in towns and cities which offer plenty of hiding places for tanks and tank destroyers but make life difficult for artillery other maps feature elevated positions that teams often fight for control of early in a battle but no game is ever over until a base has been captured or a team has been completely destroyed because it039s entirely possible for just one player to turn the tide of a battle or at the very least to stick it out for the remainder of the 15-minute time limit so that it ends in a draw http:youtubeekxxeujebdkhttp:youtubeekxxeujebdkwotjinglesworld of tanksgamingwar thundervideo game industrytank inventionfv304centurion 71m46 pattonquickybabyquickybabytvquickybabywotworld of tankswargametankwargaminggameplaywotworld of tanksgameplaywotstrategyfree 2 playonlinetanks 2video game industryfree gamesgamesrole-playing game gamermultiplayervideogamespremiumbohemianeaglejinglessovietrussianfrenchamericangermanbalance changeswotworld of tanksthe mighty jingleschurchill mark 1amx50be-50e-75rare tanksworld of tanks sidestrafebt-svm6a2e1tank inventionm4a3e8is-7amx 50 100e-100war thunderwargamingnetwargamingworld of tankswgtv-wotworldoftankstankwargamingwotwgtvwotwgtvnewswgtvupdatereviewwgtv-wotworld of tanksworld of tanks xbox 360world of tanks gameplayworld of tanks blitzworld of tanks trailerclick the link bellow to get your world of tanks now
the liquid nitrogen tanks of new york

http:wwwtomscottcom - http:twittercomtomscott - i was walking through new york and found a couple of seemingly-abandoned liquid nitrogen tanks on the street except they weren039t abandoned: they were full making a very quiet hissing noise and plumbed into somewhere i did a bit of research and found out why they039re really therethanks to david bodycombe who tipped me off to the tanks039 existence: i was planning to go looking for them but instead i just found them casually sitting on the street corner while i was headed to the rockefeller center
shark tank039s kevin o039leary schools cnn039s erin burnett on economics and the quot1quot

shark tank039s kevin o039leary schools cnn039s erin burnett on economics and government more here: http:wwwthenewscommentercomnewsshark-tanks-kevin-oleary-schools-cnns-erin-burnett-on-economics-and-the-art-of-class-war76676