collect the videos you love
collect | share | explore
Tag results for ray
sort by: relevance | recent
Results from all user's collections (3178 out of ~3,178)
2006 three-point shootout highlights

this is a highlight video i made for the 2006 nba three-point shootout it is a music video featuring clean version of the song quotbig things poppin039quot
with eye on china obama boosts us military presence in australia

president obama announced wednesday that more than 2000 american troops are heading to australia under a new security agreement but chinese leaders expressed some skepticism and displeasure at the move ray suarez reports
epileptic techno - your favorite martian music video

download the mp3: http:bitlyvwknquour facebook: http:wwwfacebookcomurfavoritemartian
friend zone - your favorite martian music video

download the mp3 mp3: http:itunesapplecomusalbumfriend-zone-singleid492432145our facebook: http:wwwfacebookcomurfavoritemartian
complicated - your favorite martian music video

download the mp3: http:itunesapplecomusalbumcomplicated-singleid510724592our facebook: http:wwwfacebookcomurfavoritemartian
vegan food is better than regular food - is it true

comedians teddy ray danny rag and pretty ricki take a blind taste test to see if it039s true that vegan food is better than regular food teddyraycomedydannyragmsprettyrickidavegangurusubscribe today http:wwwyoutubecomuseralldefdigitalsub_confirmation=1 connect with add https:twittercomalldefdigitalhttp:instagramcomalldefdigitalhttp:bitlyaddfacebookhttp:bitlyaddgooglepluscreditsstarring: teddy ray danny rag pretty ricki and vegan guru directed by: josh gonzalesproduced by: travis brown cinematographer: adam bialcam op: charles gibsonsound mixer: anthony kozlowskiproduction assistant: julia chong vfx: arthur castilloeditor: dujuana jonesassistant editor: bryan nam
gay fire

czech this out: http:bitlypsbutzsubscribe ampamp join the dark side :d http:bitlysubscriberwj---------------------------------------------my twitter: https:twittercomraywj my facebook: http:wwwfacebookcomraywilliamjohnsonmy google http:gplustoraywjstore: http:shopraywjcomwebsite: http:raywjcomhere are the links to the full reviews of the content discussed in this video please don039t harass the video creators or send them hate-messages if you like what you see on each of their channels feel free to subscribe to them : thanx:close call: http:youtubejoa1kkd7aoamultiple homosexuals witness a fire: http:wwwyoutubecomwatchv=5sakp7-71awbest ragu ad: http:youtubejwd0wumo8jk
current courage: he hit the sandman

an inspirational story of quotthe one-arm banditquot fighter baxter humby and his journey to make it into the ufc featuring sugar ray leonard producer and talent crystal fambrini
sam dubose shooting: two men claim video shows former officer ray tensing harassing them in 2014

ray tensing is charged with the murder of sam dubose during a traffic stop on july 19 demetrius pace says his video shows former university of cincinnati police officer ray tensing harassing him and his relative the driver during a traffic stop in 2014 the driver studied criminal justice and took control of the situationsources: https:wwwyoutubecomwatcht=219ampv=gbaqxiakh6a http:wwwbuzzfeedcomtasneemnashrullatwo-black-men-took-video-of-a-tense-2014-traffic-stop-with-abffbnewsamputm_term=4ldqphouganqrmq0psubscribe for more videos: http:wwwyoutubecomchannelucv3nm3t-xagvhkh9jt0virgsub_confirmation=1like us on facebook: https:wwwfacebookcomajplusenglishdownload the aj app at http:wwwajplusnetfollow us on twitter: https:twittercomajplus
atheist039s best kept secret

an atheist believes nothing made everything a scientific impossibilityquotspace and time both started at the big bang and therefore there was nothing before itquotcornell university http:curiousastrocornelleduquestionphpnumber=364dozens of quotes saying the same type of thing:http:wwwyoutubecomwatchfeature=player_embeddedampampv=fwq0lahnnyy
the lord of the rings: the two towers - hornburg

check out the quotscene of the weekquot from the lord of the rings: the two towers follow us on facebook http:onfbmelotrfb
occupy wall street police captain ray lewis joins ows gives advice 99

uploaded by rohbss on nov 17 2011he got arrested today occupy global livestreams http:occupywallstorg or http:occupystreamcom ron paul http:wwwcampaignforlibertyorg freedom to fascism http:wwwyoutubecomwatchv=azz-aoufbhsampampfeature=channel_video_title know who runs the world the federal reserve system was fraudulently created ampamp it039s counterfeiting notes quotthe dollarquot is illegal ampamp unconstitutional only gold ampamp silver can be money ampamp paper money must be back by gold or silver like it used it be before 1913 when they took control of this country and took us off the gold ampamp silver standard ampamp devalued the dollar by 98 by printing money ampamp creating inflation they get your income tax money ampamp it039s says on the application means to beg voluntary compliance people get in trouble when they lie about the info i am part of the 99 ampamp have 1 demand end the fed ampamp i have a leader who is running for president ron paul real news http:rtcom occupy ampamp end the fed http:occupythefednet zero interest rate for the people not the banks the people039s own gold ampamp silver non profit money ampamp bank system join ron paul ampamp the info war alex jones ampamp occupy the world before you are starving to death or martial law is declared the bad guys will run the world until a majority wake up ampamp make personal sacrifices check out the world freeman society http:thinkfreeca become a freeman on the land ampamp know the deceptions of the law statues ampamp acts are not law ampamp need your consent like stating your name or showing id don039t enter the law society yes you may get arrested by not showing your id or stating your name but it039s not illegal ampamp if you know the law the judge will set you free ampamp not fine you because it039s not obstruction investigate robert menard johnny liberty mary croft john harris haley bazley robert christy froid psychology huxley philosophy think free birth certificate citizen claim of right constitution tax application legalese sovereign illegal lawful strawman statues acts blacks law dictionary tpuc lawyer society unalienable rights commerce maritime admiralty common ucc uniform commercial code contract consent civil corruption central bank property employee franchisee karma reincarnation enlightenment united states passport legal fiction register court judge property imf wto foreclosure social security medicaid medicare debt consent blacks law society sovereignty osama bin laden death al qaeda terrorist haarp chemtrails fema coast to coast am gas oil price middle east 2012 conspiracy terror food crisis gold silver revolution inflation ron paul obama zeitgeist disaster riots protests jobs alex jones retaliation prison planet info wars nature corporation wikileaks climate change police state meditation constitutional jesus christ ufo039s aliens tea party rand paul jesse ventura david icke gerald celente max keiser mayan spirituality free tibet china tyranny terrorism consciousness world war 3 buddhism tao zen god truth justice knowledge wise slavery history freedom fluoride peace love history terrorism fluoridation science government occupation information deception paradigm matrix law america recession inflation economy stock market bush depression nwo space ipad mac mind control mars moon earth mother martix brain mind drugs pot psychedelic iphone hinduism meditation egypt libya jews israel mayan new york 911 lies conspiracy theory sovereign state imf wto rockefeller bilderberg act register world bank apply free federal reserve conspiracy theory slavery islamic yemen pakistan afghanistan syria saudi arabia persians sunni shiite yemen muslim brotherhood islam iran iraq israel ground zero pentagon 911 common maritime admiralty law monsanto seeds farms fda fbi cia homeland security crops cops 2011 fda health rock sovereignty universe planet star illusion paradigm cars homes religion budda martial arts national obama budget profit deficit bankruptcy court police bob chapman linsey williams project camelot avalon graham hancock peter shiff gerald celente sovereignty charlie sheen earthquake tsunami nuclear japan radiation shutdown evacuation meltdown precession of the equinox universe planet x space earth mars venus nibiru comet wormwood leonid elenin brown dwarf star nemesis binary solar system galaxy eris volcano 111111 tail coma annunaki anunnaki sumerian hopi indians prophecy pole shift magnetic field solar flares sun revelation apocalypse rapture bible code christian blue red kachina tail coma tyche sumerian pakistan fukushima default debt stock market crash peter schiff max keiser rt oath keepers tsarion occupy wall street end the fed alan watts truth movement we are the 99 we are change ows fast and furious cia fbi nato anonymous marine soldier vs nypd cops sergeant thomas occupy marines a new alliance tear gas ows occupy together zuccotti park tsa
nasa colliding neutron stars create black hole and gamma-ray burst

armed with state-of-the-art supercomputer models scientists have shown that colliding neutron stars can produce the energetic jet required for a gamma-ray burst earlier simulations demonstrated that mergers could make black holes others had shown that the high-speed particle jets needed to make a gamma-ray burst would continue if placed in the swirling wreckage of a recent mergernow the simulations reveal the middle step of the process--how the merging stars039 magnetic field organizes itself into outwardly directed components capable of forming a jet the damiana supercomputer at germany039s max planck institute for gravitational physics needed six weeks to reveal the details of a process that unfolds in just 35 thousandths of a second--less than the blink of an eyethis video is public domain and can be downloaded at: http:svsgsfcnasagovgoto10740like our videos subscribe to nasa039s goddard shorts hd podcast:http:svsgsfcnasagovvisitunesf0004_indexhtmlor find nasa goddard space flight center on facebook:http:wwwfacebookcomnasagsfcor find us on twitter:http:twittercomnasagoddard
nude protest of airport body scanners in germany

the intelligence connected fruit-of-the-loom bombers on yes there were two of the same runs that day: http:tinyurlcom2bmplfd christmas day attack has prompted calls for the increased use of full-body scanners at airportsso to protest members of the pirate party in germany organized a fleshmob of people who stripped down to their skivvies last sunday and converged on the berlin-tegal airportthe protesters marked their bodies with a number of messages such as something to hide and be a good citizen drop your pantsone woman has the word diaper scrawled on her lower back with an arrow pointing to her underwear and the word prosthetic printed on her leg the word piercing and an arrow point to one of her breaststhe full-body scanners use high-frequency radio waves to produce an image of a passengers naked body beneath clothes anything a passenger is carrying against the body weapons drugs or explosives would be exposed the scanners would also reveal the presence of prosthetic devices and breast implantsas such there have been privacy and legal concerns raised about the invasive equipment particularly because its unclear if the scanners would be able to detect explosives hidden in body cavities and would therefore likely provide only minimal securityquotthe right of the people to be secure in their persons houses papers and effects against unreasonable searches and seizures shall not be violated and no warrants shall issue but upon probable cause supported by oath or affirmation and particularly describing the place to be searched and the persons or things to be seizedquot - fourth amendment to the united states constitutionif you believe in the united states constitution and the bill of rights then please join us in taking a stand against the out-of-control tsa and its sexual molestation of air travelershttp:redactednewscomtsa quotsecurityquot monkeys flunk physics and evolutionhttp:tinyurlcomtsa-physicspilots passengers parents rail at new perverted pat downs: stepped-up security airport screening provokes outcry to tsahttp:tinyurlcomfirst-cavity-searchpolice state: tsa launches investigation into man who refused groping naked body scanhttp:tinyurlcomnot-my-junkpaying to be rapedhttp:tinyurlcompay-rapeobama039s new healthcare plan: bridge tsa and department of health ampamp human services with the tourism industryhttp:tinyurlcomtsa-healthcareex-dhs chertoff039s rapescan x-ray scammers: selling police state cancer to an airport near youhttp:tinyurlcomchertoff-rapescandhs porn: tsa trading sanitary napkin images of naked body scans like baseball cardshttp:tinyurlcomtsa-tampondhs pedophilia: body-searching children - no for the us military yes for the tsahttp:tinyurlcomtsa-pedophiliatsa: nazi fcktards and their pedophilic sexual predation - are you ever going to get angryhttp:tinyurlcomtsa-nazi
jon stewart goes after nfl over ray rice - quot you done fcked up quot

september 10 2014 - jon stewart really went after the nfl wednesday night over their mishandling of the ray rice fiasco stewart put the frustration most bluntly when he said you done fucked up stewart first went after the lenient punishment the nfl gave him before they saw the video this week when everything changed stewart laughed at roger goodell for saying he wasnt provided the video mock-declaring the king of video never bestowed upon you the opportunity for you are just a simple peasant boy commissionerand in spite of a new report saying the nfl did get the video after all theyre still denying they saw it stewart found that really hard to believe especially given the leagues obsessive-compulsive tape watching addictions when it comes to looking at their games from every conceivable angle possible