collect the videos you love
collect | share | explore
Tag results for making
sort by: relevance | recent
Results from all user's collections (13173 out of ~13,173)
the ultimate guide to sushi making knife giveaway

for anyone that wants to take a crash course in sushi making i am going over every single step to help you make the most delicious yet simple sushi contest details below for the contest to win a 100 knife usa onlylike the video and email brothersgreentreatsgmailcom with a screenshotpicture of where you shared this video to and you may just win this knife: http:amznto2livakjin this video we are covering: how to make sushi rice how to select the right fish how to cut fish how to make wasabi how to make pickled ginger how to select seaweed how to roll sushi and how to cut sushi part two we will get into more advanced rolls enjoyyou know you can buy all of the equipmentgear you see in this video here: https:kitcombrothersgreenfollow brothers green here: http:bitly2d6kp5dmusic bydan and drumhttps:soundcloudcomdandrumandlakey inspiredhttps:soundcloudcomkzchillmode
making music without hearing it

in conclusion we recommend making music while hearing it rob039s video: https:youtubej1sbe_zalu0subscribe for constant music weirdness http:bitlysubscribetoandrewhuangroomie: http:youtubecomroomieofficialdave: http:youtubecomwwwboyinabandcomrob: http:youtubecomrobscallonsupport my work on patreon: http:patreoncomandrewhuang watch more my uncut take of producing the track without hearing it:https:youtubeqrms2kzhyt8play our epic youtube video gamehttps:youtube-z5hxz-rhl0 follow me here instagram http:instagramcomandrewismusictwitter http:twittercomandrewhuangfacebook http:facebookcomandrewismusic listen to my real music spotify http:spotifi2pf0qrbitunes http:appleco2psaumlgoogle play http:bitly2qlhajybandcamp http:bitly2orwcby y039all always ask about gear workhorse camera http:amznto2ahkv35cinematic camera http:amznto1rjk8n9travel camera http:amznto2ayp5iicamera stabil
i tried making kinetic sand

how to make kinetic sand i try making my own by mixing a small amount of slime with colored craft sand this recipe turn out pretty well great project to make with kids at home slime videos here:https:wwwyoutubecomwatchv=bz1wmekir78ampt=4samplist=plq_t2nppe0pjbzfgorfw1itnazhrfxpz1ampindex=1my amazon shop here:https:wwwamazoncomshopdavehaxamazon influencer affiliate shopcontribute subtitles here:http:wwwyoutubecomtimedtext_videoref=shareampv=kemqo35m8gklatest videos - https:wwwyoutubecomwatchv=ufug_vlv-biamplist=plq_t2nppe0pl_mge6mlzdhfokjsilzj7bfun science projects: https:wwwyoutubecomwatchv=z50jei1ignqamplist=plq_t2nppe0pihhn2xezgg0dggq7umbtmofood and cooking hacks - https:wwwyoutubecomwatchv=mbheddanrzsamplist=plq_t2nppe0pjvjefaoibp4p0ns8nudgqbamazing life hacks - https:wwwyoutubecomwatchv=uz6rjbw0za0amplist=plq_t2nppe0pkraqkjpgtvrff46vr1ihachow to make fun things - https:wwwyoutubecomwatchv=0ki9kta8g14amplist=plq_t2nppe0pi
halsey - the making of bad at love

quotbad at love appears on halseys album hopeless fountain kingdomlisten to quotquotbad at lovequotquot on apple music: http:wwwiamhalseycominsidemyheadapplelisten to bad at love on spotify: http:wwwiamhalseycominsidemyheadorder deluxe box set limited edition vinyl amp more in the official store: http:wwwiamhalseycomstoreorder album on itunes: http:wwwiamhalseycomhfkitunessave hopeless fountain kingdom on spotify: http:wwwiamhalseycomhfkpresaveorder deluxe edition cd on targetcom: http:wwwiamhalseycomhfktarget order urban outfitters exclusive red-splattered clear vinyl: http:wwwiamhalseycomhfkuovinylfollow halseyhttp:iamhalseycomhttp:twittercomhalseyhttps:wwwfacebookcomhalseymusichttp:instagramcomiamhalseyspotify: http:wwwiamhalseycomspotifymailing list: http:wwwiamhalseycommailinglistmusic video by halsey performing the making of bad at love c 2017 astralwerkshttp:vevolydhdcbc
video: bnice feat ean j - enormous otp records submitted

otp records recording artist bnice amp ean j otpgang filmed the enormous video in miami florida and have been traveling city to city state to state spreading their sound making their brand prominent enormous has held the number 1 most requested song on underground dadecounty radio the past two months otp records is an independent label making major moves in the music industry
jimmy carr question time

what a legend lol
gulp the making of

here039s a film taking you behind the scenes on 039gulp039 aardman039s world record breaking short film it reveals what went in to making such a complex film outside and away from the controlled environment of a studio and how it was shot using a nokia n8to learn more about nokia n8 visit: http:nokialyclyhi2
essentials to start making money online - free e-course on starting earning money from home

start making money online http:wwwmyfastcashsystemnetrevealed for free the essentials of earning a real income online slap the learning curve and get ready to start making some money grab this free e-course now and you can start earning money from homehttp:wwwyoutubecomwatchv=qy0jmt289hu
quick money making ideas a mymobilemoneypages review

http:youtuberedirectcommymobilemoneypagescomquick money making ideas with just 3 easy steps1 create the site2 create hot money keywords3 paste the keyword into your siteno domain needed and no hosting needed everything provided for you
google sniper by george brown-best internet marketing system

http:gsniperojuolacomclick on the link above to join the creatorgeorge brown and the few lucky people who are currently tapping into this 196 billion dollar pie called google snipperit doesn039t require any technical set upall you need to do is follow along and c doesopy what george brown does it039s free-no paid advertisingno need to worry about costsexpenses and technical mumbo jumboevery cent the system makes for you is 100 profitin google sniperwe simply follow the following simple steps:step 1 follow along and copy george brownstep 2 put your sniper campaign live on the internetstep 3 sit back and watch as your campaign grows and the cash floods into your bank account all you need is just a computer and an internet connectionstart here: http:gsniperojuolacom
internet earning amp online earnings mean online wealth

internet earning amp online earnings mean online wealth http:tenstepstowealthcom a great way to begin wealth creation if wealth building is important to youin 3 years 8 months paul counsel went from broke to multi millionaire watch as he presents his quotbig ah ha momentvideo 1: in a series of nine begins by looking at the money mindset which leads to wealth online and online wealthit039s critically important to create your millionaire mind first if your money code doesnt change then online earnings making wealth or your ability to make wealth will not be achieved without the mind of a millionaire the millionaire club fails to become a realitymoney drivers must create a new mindset so you can dramatically improve your money resultsbegin building wealth by using paul counsel039s wealth changing results and his online wealth ecourse the ten steps to wealth its available with other complimentary educational resources at wwwtenstepstowealthcomwebsite: http:tenstepstowealthcomwebsite: http:paulcounselcomaublog: http:tenstepstowealthcombloggoogle: https:plusgooglecomgpsrc=gplp0105367733661235514919posts
diy solar panels video testimonial for earth4energy

build your own solar panels with an easy solar panels installation guide to save electricity bills buy earth4energy as it039s the perfect green solution to save thousands of electricity bills also this home power generation can be saved up for blacked out days making solar panels by the guide of earth4energy is carefully crafted for 039average joe039 anybody can build their own solar panels begin powering your home from clean and green solar energy start living greenmore reviews and articles about residential solar panels amp earth4energy here http:residential-solar-panels-reviewblogspotcom
the easiest way to make money online on autopilot

http:wwwsmartonlineincomeorg discover how you can start making money online as soon as today
empower network boot camp day 1

empower network boot camp video 1sign up today earn 100 commission from homehttps:wwwempowernetworkcomjoinphpid=alex242
making more money easy way - mr3m039s - cash fast

i am providing you a service to help people become financially free and also showing you way to make money now with no money the middle class is shrinking i am here to make sure you have the right tools to be in the upper class and not the lower class working a job which means just over broke follow me on twitter at https:twittercommrtriplems or wwwfacebookcomlamons3m or http:wwwmr3msblogspotcom and http:lamonts3mcom and https:wwwyoutubecomuserbmorecareful23