collect the videos you love
collect | share | explore
Tag results for gymnastics
sort by: relevance | recent
Results from all user's collections (272 out of ~272)
1996 altanta olympics - kerri strug039s gold medal vault

great moments in olympic history http:wwwvancouvergamesforumcom
last to stop doing gymnastics wins cash prize

best gymnast wins download amp play dobre dunk http:bitlydownloaddobredunkmerch http:bitlynewdobremerchturn on our post notificationssubscribe https:wwwyoutubecomchannelucc3ogyxhwv8pb5ylobw9kdacheck out our dobre cars channelhttps:wwwyoutubecomchanneluc7irjups5a2nxstonm3jjmwfollow us instagram -http:instagramcomdobrebrotherssnapchat - https:wwwsnapchatcomdiscoverdobre_brothers5255767112cyrusinstagram - cyrusdobretwitter - cyrusdobremusically - cyrusdobredariusinstagram - dariusdobretwitter - dariusdobremusically - dariusdobrelucas instagram - lucas_dobretwitter - dobrelucasmusically dobretwinsmarcusinstagram - marcusdobretwitter - dobremarcusmusically - dobretwinsbiz - dobrebrothersmgmtgmailcomthanks for watching :last to stop doing gymnastics wins cash prizehttps:wwwyoutubecomchannelucc3ogyxhwv8pb5ylobw9kda
collection of painful parkour fails

an up to date collection of the nets brutalist pakour and freerunning bails fails and bloody trailslet me know if you feature or if you have any bails youamp039d like to submit for the next volumethanksjack edwardsbenozzykieamish shaun woodufpip andersentom hikeyhamza shabazzzadeukthesnowmanfilmcallum powellkane armitagephil doylescott bassshaneman68 maria quantockwatafupad chandlersarkparkourchris ilabaccadaniel ilabaccajonah mayfieldconor dohoutythepatrik94erik aleynikovgouldfish jj goda and zakdickrules89shaneman68bluntmanfrtwntyflipslinkygrafdavid motherfucking belleand anyone else who iamp039ve missednoisia and foriegn beggars contact
artistic gymnastics fails: falls amp bloopers compilation

women039s artistic gymnastics fails crashes mistakes falls bloopers and accidents video compilation from the 1970s to 2012top gymnasts:0:01 - jade barbosa0:18 - elena zamolodchikova0:46 - shannon miller1:00 - alicia sacramone1:39 - elena zamolodchikova1:53 - dominique moceanu2:11 - yekaterina lobaznyuk2:14 - viktoria karpenko2:17 - yang bo2:34 - gina gogean3:00 - anna pavlova3:08 - alicia sacramone3:15 - svetlana khorkina3:20 - svetlana khorkina3:37 - ludmila tourischeva3:50 - lilia podkopayeva4:44 - alexandra marinescu4:52 - li shanshanenjoy the best video of epic artistic gymnastics accidents bloopers falls amp fails compilation in women039s and girls gymnasticsgymnastics is a sport which requires hard training mental strength and determination gymnasts train many hours every day to perform the amazing skills we see but in a split second a mistake can shatter their dreams and years and years of training this video is an homage to those gir
helena rakoczy - 1950 gymnastics worlds - floor

helena rakoczy poland at the 1950 world gymnastics championships floor exerciserakoczy won the all around artistic gymnastics competition in basel switzerland and also got gold on floorother gymnastics videos you might like:- helena rakoczy - 1950 gymnastics worlds - balance beam: https:youtube-r3p-z6gbfs- 1936 olympics gymnastics: https:youtubeqyopsk-wy_i- olympic gymnastics aa champions 1972 - 2016: https:youtubeg-tdb9p3hn0music:and awaken - stings by kevin macleod is licensed under a creative commons attribution license https:creativecommonsorglicensesby40source: http:incompetechcommusicroyalty-freeindexhtmlisrc=usuan1100331artist: http:incompetechcom=====================if you want to see the most amazing gymnasts performing the most difficult skills gymnastico is your channelfrom national championships to the olympic games to world championships watch the world039s best gymnasticscomment to meet fellow art
daria spiridonova balance beam aa reykjavik international games 2017 - gymnastics

daria spiridonova rus at the reykjavik international games 2017 all around on balance beamlike this video share it leave a comment below and subscribe for more gymnastics videos
andreea raducan gymnastics tribute

andreea raducan gymnastics video montage dedicated to the winner of the sydney 2000 olympics gymnastics all around gold medal romanian gymnast andreea careful not to spell it andrea by mistake raducan started to grab international attention as a junior in 1997 and in 1999 she world her first individual medal on floor andreea went on to win the artistic gymnastics all around competition at the 2000 sydney olympics but she was later stripped of her medal for taking an over-the-counter cold medicine which has seen been removed from the banned substances list for fans she still remains the sydney olympic games 2000 championother gymnastics videos you might like: - nastia liukin gymnastics tribute: https:youtubelbuids0agpu - best olympics gymnastics moments rio 2016: https:youtubedkjh6zjlbf4 - olympic gymnastics aa champions 1972 - 2016: https:youtubeg-tdb9p3hn0music: succotash silent partner master of the feast by kevin macleod is licensed under a creative commons attribution license h
agnes keleti - 1952 olympics gymnastics - floor

hungarian gymnast agnes keleti at the helsinki 1952 olympics gymnastics gala on flooragnes keleti won the gold medal on this artistic gymnastics eventagnes is an holocaust survivor who had to go into hiding during wwii to avoid being sent to a concentration camp by the nazis but many of her relatives were killed in auschwitzother gymnastics videos you might like:- helena rakoczy - 1950 gymnastics worlds - floor: https:youtubeyh-syeheuog- margit korondi - 1952 olympics gymnastics - balance beam: https:youtubev3csz3m9c4m- olympic gymnastics aa champions 1972 - 2016: https:youtubeg-tdb9p3hn0music:lift motif by kevin macleod is licensed under a creative commons attribution license https:creativecommonsorglicensesby40source: http:incompetechcommusicroyalty-freeindexhtmlisrc=usuan1100176artist: http:incompetechcom=====================if you want to see the most amazing gymnasts performing the most difficult skills gymnastico is yo
luo huan - melbourne 2017 gymnastics world cup ef - balance beam

luo huan chn - melbourne 2017 gymnastics world cup ef - balance beamlike this video share it leave a comment below and subscribe for more gymnastics videos
abigail brenner - 2017 nastia liukin cup - balance beam gymnastics

abigail brenner usa - 2017 nastia liukin cup - balance beamlike this video share it leave a comment below and subscribe for more gymnastics videos
komachi

watch komachi 2025 runtime: 36:15 categories: small bow lower breast gymnastics uniform hornyhill hornyhillse
princess 69 midnight gymnastics vol1 eng dub

watch princess 69 midnight gymnastics vol1 eng dub 2025 runtime: 2954:37 categories: hentai anime princess69 midnightgymnastics gymnastics leotard hornyhill hornyhillse
i need you i don039t need you

riley on monkey bars
usa gymnast039s parents reactions as they watch daughter roller coaster ride

usa gymnast aly raisman039s parents look asic they are on a roller coaster ride watching daughter perform
kim zmeskal - 1991 worlds all-around fx

kim zmeskal performs her floor exercise routine at the 1991 world gymnastics championships in the all-around competition scoring a 9987 and winning the gold medal