Tag results for gun
sort by: relevance | recent
Results from all user's collections (2277 out of ~2,277)
|
nhav002 hook up meet first love dream come true on wedding night
Bookmarked 47 weeks ago watch nhav002 hook up meet first love dream come true on wedding night 2024 runtime: 30:56 categories: china asian chinese uniform stockings madou side story about a gun white silk nono hornyhill hornyhillse |
|
cus-2023 the 18-year-old girl who comes to your door will give you the feeling of first love
Bookmarked 47 weeks ago watch cus-2023 the 18-year-old girl who comes to your door will give you the feeling of first love 2024 runtime: 33:12 categories: china asian chinese uniform 69 idol about a gun poor tits month after month hornyhill hornyhillse |
|
natali campus confessions two
Bookmarked 49 weeks ago watch natali campus confessions two 2021 frank gun runtime: 15:55 categories: frank gun american 18 year old anal cumshot doggy style eating pussy kissing orgasm hornyhill hornyhillse |
|
lullu gun gets spit roasted outside by two crazy fuckers
Bookmarked 48 weeks ago watch lullu gun gets spit roasted outside by two crazy fuckers 2021 lullu gun runtime: 17:07 categories: lullu gun wolf wagner com teen 18 outdoor interracial blowjob amateur threesome public reality hornyhill hornyhillse |
|
uk milf is hottest english teacher - miss sally martin gun
Bookmarked 3 weeks ago watch uk milf is hottest english teacher - miss sally martin gun 2025 martin gunmiss sally runtime: 06:56 categories: martin gun miss sally amateur cumshot big dick blowjob big tits pov blonde milf hornyhill hornyhillse |
|
electric cannon masturbation
Bookmarked 8 weeks ago watch electric cannon masturbation in 4k ultra hd presented by non studio |
|
lifemates: act of valor
Bookmarked 705 weeks ago santos watches quotact of valorquot and gets the sudden urge to become a navy seal soop is not so happywritten by greg santosperformed by greg santos and jared soopertwittercomgregorysantostwittercomjaredsooperdirected by: eric mendozaedited by: tania leivawwwoceanparkfilmscom |
|
nachbarstochter treibt es wild in altem haus nebenan
Bookmarked 38 weeks ago watch nachbarstochter treibt es wild in altem haus nebenan 2017 lullu gun runtime: 14:54 categories: lullu gun lullu gun german deep throat hd videos hardcore skinny teen deep deep throated deep throats german hardcore german scout hardcore skinny hardcore teens scout skinny teens teens throat throat deep wild hornyhill hornyhillse |
|
fucking crazy minds - vol 35
Bookmarked 38 weeks ago watch fucking crazy minds - vol 35 2022 frank gunmandy bright runtime: 29:06 categories: frank gun mandy bright faphouse frank gun mandy bright american big cock hardcore orgasm pornstar retro vintage big pornstars cock cocks crazy fucking fucking big cocks fucks hardcore porn hardcore x porn fuck hornyhill hornyhillse |
|
us military rifles since 1776
Bookmarked 510 weeks ago please read before commenting: a very basic overview of some of the main us military rifles since the 18th century we mainly look at the evolution of the technology in primary issue rifles or rifles similar to them that i happen to own since i chat unscripted without a leash for 35 minutes you can imagine that i have a little clean-up to do :- i039ll add needed correction here in the description below i won039t add much elaboration as this is not meant to be a video about the entire history or everything about these specific firearms it039s more of a basics video as i state at the beginning to give folks something of a picture of the major stepping stones in military musket rifle development through the last 200 yearssome clarification or further basic information:1 the brown bess is a smooth bore musket like most shotgun barrels i mistakenly call it a rifle in the video i don039t think i mention it but the 1858 enfield used in the civil war has a rifled barrel as do all the firearms on the table after the brown bess2 the tubular magazines of lever guns are not safe with pointed bullets think about it :- the 1895 winchester lever gun solved this by not using the tubular magazine but with most lever guns we were limited to flatter-nosed bullets the bolt gun with rounds stacked on top of one another allowed as sharp a point on the bullet as we wanted3 for some reason brain fade i failed to show you how the garand loads guess most of you have seen it in the movies at least and hopefully in our garand videos :-4 i believe eugene stoner was developing the ar-10 even before the 03960s but the ar15m16 did not get into soldiers hands until the 03960s i believewe have videos on all these firearms please search from the home page for any of these firearms and you039ll find at least one video i believe |
|
flak 1944 us army air forces training film anti-aircraft artillery aaa
Bookmarked 397 weeks ago more at http:scitechquickfoundnetaviation_news_and_searchhtmlexplains flak anti-aircraft artillery avoidance tactics to world war ii pilots and bomber crewsus army training film tf1-3389new version with improved video amp sound: https:wwwyoutubecomwatchv=erjc2mkrzksreupload of a previously uploaded film in one piece instead of multiple partspublic domain film from the national archives slightly cropped to remove uneven edges with the aspect ratio corrected and mild video noise reduction appliedthe soundtrack was also processed with volume normalization noise reduction clipping reduction and equalization the resulting sound though not perfect is far less noisy than the originalhttp:creativecommonsorglicensesby-sa30http:enwikipediaorgwikianti-aircraft_warfareimportant non-english terms for air defence include german flak from the german fliegerabwehrkanone aircraft defence cannon also cited as flugzeugabwehrkanone or flugabwehrkanone and the ru |
|
batman cosplay breaks world record - meet the record breakers
Bookmarked 482 weeks ago an incredible batman outfit adorned with 23 functioning gadgets has earned its owner the world record for the most functional gadgets on a cos-play suit read more here: http:bitlygwr-batman subscribe for more: http:bitlysubscribetogwrguinness world records 2017: gamers edition is available september 2016stephen daultrey editor of the guinness world records 2017: gamers edition said: this incredible cosplay suit is a great example of the eclectic records that appear in this years gamers edition 2017 the detail and imagination behind the gadgets take the meaning of cosplay to a whole new leveljulian039s batman cosplay suit gadgets include: 1 fireball shooter2 gauntlet video screens x 2 3 bat tracking beacon 4 bat sign projector 5 folding batarang 6 grapnel gun 7 cowl respirator 8 pneumatic tranquilliser gun9 ultrasonic anti dog device 10 bat shuriken x 4 11 uv lamp 12 ball bearing grenades x 2 13 gauntlet flashlight 14 medi-kit15 battery |
|
an ar-10 made from bullet brass quotthe golden gunquot guncraft101
Bookmarked 384 weeks ago i start out making a wooden pattern to make a greensand mold then i melt 1425 brass casings of various sizes to make a 13 pound blank then the machining begins after many hours of precision machining i039m left withwell watch the video and you039ll seei was incorrect when i stated that many of the primers are aluminum i knew they were silver and non-magnetic so i ass-umed aluminum i039ve since learned that older primers were copper occasionally nickel plated for corrosion resistance most of the newer primers are brass and again the silver colored ones are nickel plated answers to faq039s:- no it039s not for sale- this took around 60 hours total build time the brass was significantly harder to machine than the aluminum can lower so each cut took longer- i don039t expect any problems with it holding up over time they make these out of plastic and they work fine the lower receiver doesn039t take that much stress in use with an ar platform- my mill is |
|
electromagnetic railgun firing hypervelocity projectile mach 7
Bookmarked 330 weeks ago watch hyper velocity projectile hvp being demonstrated at us navy039s research labsthe hvp is a next-generation common low drag guided projectile capable of completing multiple missions for gun systems such as the navy 5-inch 155-mm and future railguns types of missions performed will depend on gun system and platform the program goal is to address mission requirements in the areas of naval surface fire support cruise missile defense anti-surface warfare and other future naval mission areas hvps low drag aerodynamic design enables high-velocity maneuverability and decreased time-to-target these attributes coupled with accurate guidance electronics provide low-cost mission effectiveness against current threats and the ability to adapt to air and surface threats of the future wwwonrnavymilenmedia-centerfact-sheetshypervelocity-projectileaspxquotenergetic weapons such as em railguns are the future of naval combatquot said rear adm matt klunder the chief of naval re |
|
squib load danger
Bookmarked 431 weeks ago demonstrating and discussing the dangers of having a squib load------------------------ please go to our website and check out what the great folks who support us have to offer: buds gun shop the national rifle association federal premium and sonoran desert institute: http:wwwhickok45comsupportersjoin the nra at the hickok45 page and get a nice discount: https:membershipnraorghickok45joinhickok45 store: http:shopmissinginkcomhickok45storefederal premium: http:wwwfederalpremiumcom https:wwwfacebookcomfederalpremiumammosdi sonoran desert institute: http:wwwsdiedu upcoming meet amp greets lexington ky at the outdoor show ------ saturday august 26th from 10:00 to 12:00 at the buds gun shop booth at the outdoor show lexington ky were also going to be at the clarksville tn friends of nra banquet that same night 8-26-17 for those planning on attending that event also everybody remember to bookmark andor subscribe over on full30 |