collect the videos you love
collect | share | explore
Tag results for digg
sort by: relevance | recent
Results from all user's collections (329 out of ~329)
new machete red band trailer for cinco de mayo video

51208cubs vs diamondbacksthis guy jumps on the field starts running and gets nailed
video of swat raid on missouri family

this video shows a search warrant served by the columbia mo police department the cops bust in this guys house in the middle of the night and shoot his two dogs one a pit bull that was caged in the kitchen and the other a corgi with children in the home it turns out that rather than a big time drug dealer this guy had a small pipe with some resin in it a grinder and what the cops here call ampquota small amount of marijuanaampquot meaning less than a few grams we here in comlumbia want everyone to know what kind of police department we have here check out our ampquotfinestampquot in action
a very strange moustache club video

tash-tastic
holy shit chrome is fast trippy video

these speed tests were filmed at actual web page rendering times if youamp039re interested in the technical details read onequipment used: - computer: macbook pro laptop with windows installed- monitor - 24ampquot asus: we had to replace the standard fluorescent backlight with very large tungsten fixtures to funnel in more light to capture the screen in addition we flipped the monitor 180 degrees to eliminate a shadow from the driver board and set the system preferences on the computer to rotate 180 degrees no special software was used in this process- 15mbps internet connection - camera: phantom v640 high speed camera at 1920 x 1080 films up to 2700 fpsampquotwhy does allrecipescom in the potato gun sequence appear at once and not the text first and images second and why does it appear to render from bottom of the screen to the topampquotchrome sends the rendered page to the video card buffer all at once which is why allrecipescom appears at once and not with the text first and images second chrome actually paints the page from top to bottom but to eliminate a shadow from the driver board we had to flip the monitor upside down and set the system preferences in windows to rotate everything 180 degrees resulting in the page appearing to render from bottom to topampquotwhy does the top one third of the page appear first on the weathercom page loadampquotsometimes only half the buffer gets filled before the video card sends its buffer over to the lcd panel this is because chrome on windows uses gdi to draw which does not do v-syncampquotthe screen wipes are so smooth - how was that achievedampquotthe screen wipes up in a gradated wipe because lcd pixels take around 10ms to flip and gradually change colorfor behind-the-scenes footage of how this video was made:http:wwwyoutubecomwatchv=_oarmxgq3gi
breaking: miley cyrus is kinda a slut w vid

candy music video
a song about lactose intolerancy video

hope you choose to amp039likeamp039 without a face on facebook:http:tinyccnuqem
ipad turned into skateboard

two skaters turn your beloved ipad into a skateboard video property of fueltv
voting changes nothing - jh uk election 2010

warning: contains offensive language throughout please do not watch if easily offended or if you still take politics seriouslyvoting changes nothing: an original song and music video about the hype and hopelessness over the uk general election 2010music lyrics vocals guitars keyboards bass and production by jh drums by fud e gilchrist ii mastering by slim video by cw jb ce py and jh thanks also to bd and hjfor more information on jh and free downloads including this song go to wwwmyspacecomjhinfofree mp3 version of this song:http:soundcloudcomjhmusic2010voting-changes-nothing
ipad 3g gets nuked inside microwave video

welcome to dovetastic microwave theater today your professional microwave operator is going to be microwaving his brand new 3g 64gb ipad fresh out of the factory box strait from applewell not really but he is going to be microwaving a new wifi ipad for real for your viewing pleasure into a very special limited edtion one of a kind device do not attempt bid on the ebay auction for the artwork titled ampquoteyepadampquot made from a real working brand new 500 microwaved wifi ipad used in the making of this episode at: http:cgiebaycomwsebayisapidllviewitemampampampitem=150440194811ht_10492wt_1371remember microwaving food is for moronsbe sure to check out my other site too: http:wwwfunmicrowavecomon bragster were i am currently ranked one of the best of all timeand my youtube show here on:http:wwwmicrowaveshowcomwhere i am ranked amongst the 600 best artists ampampamp entertainers here on youtube ampampamp the webyou are watching episode hd widescreen two-hundred ampampamp seventy-twothis show is for entertainment purposes only so please do not attempt these experiments at home experiments are produced in a professional environment with proper safety equipment
military brass likes lady gaga parody

this is a couple guys located in afghanistan that re-made the music video by lady gagatelephone prepare yourself for a fantastical journeyright now this is the temporary version we have more scenes to cut and edit however with guys always on mission it is harder to film than you think
fan films himself catching home run ball during game video

watch in 720p or 1080pthis is the first game home run iamp039ve filmed myself catching but the eighth game homer iamp039ve caught caught the first seven from amp03998 to amp03902 i also caught two homers on film in bp today putting those up laterhereamp039s the tv footage of the homer:http:mlbmlbcomvideoplayjspcontent_id=7782259
you can039t trust science what about religion

ampquotscience has an agenda science is unreliableampquot if youamp039ve ever heard a religious person say these words youamp039ll love this video
the 10 funniest mascot fails videos

before the celebrity game during 2009 nba all star week rufus the charlotte bobcatsamp039 mascot tossed a basketball backwards over his head and off the groin of bango the milwaukee bucksamp039 mascot the ball went through the hoop as did bango no mascots were harmed in the making of this film we hopeupdate: bango did suffer a knee injury but will recover and continue to entertain fans before and after surgery:http:wwwnbacombucksnewsbango_injury_0900218htmlwe wish him the best
news cast gets completely owned by hackers video

the nationals racing presidents and the racing pierogies of pittsburgh have a 2-year tradition of traveling to each others ball parks when the teams play each other but after mays debacle in which the racing pierogies tricked the presidents and won a race at nationals park fans were left wondering whether the embarrassed presidents would make an appearance for this weekends nationalspirates series at pittsburghs pnc parkon friday night the question was answered when the presidents appeared for a 4-team mascot relay race abe lincoln was paired with teddy roosevelt and george washington was paired with thomas jefferson with teddy and tom poised to run anchorabe lincoln finished the opening leg in last place but on the anchor leg teddy put on a burst of speed thats when front-running pierogie oliver onion turned and ran straight into teddy leveling him to the ground