Tag results for areas
sort by: relevance | recent
Results from all user's collections (47 out of ~47)

The results from your search appear low, try our web search for better results.
|
life coaching online
Bookmarked 494 weeks ago check this link right here http:wwwfearlesspursuitscom for more information on life coaching online life coaching online is perfect for a busy person or for professionals who cannot commit to meeting face-to-face because i am able to provide life coaching online sessions it makes for a more flexible option and ensures that you get the time you need to help you reach your fullest potential get connected with your personal success coach sharon koenig and get started with your own motivational life coaching online session todayfollow us: https:theprosperitypeoplewordpresscom |
|
find happiness
Bookmarked 491 weeks ago browse this site https:twittercomwethefearless for more information on find happiness nothing beats an inspired and happy life that039s why to attract positive vibes in your life choose to be happy all the time how to find happiness in your life depends solely on your personal choice and it is this choice that matters most after all it is your life and you have the right to live it the way you want it to befollow us : https:ellocolifecoachingonline |
|
life coaching online
Bookmarked 491 weeks ago check this link right here https:wwwyoutubecomchannelucik4ghxytg2ksdj88628ahq for more information on life coaching online it seems like everyone is using life coaching online to get the help they need to make changes in their everyday situations from home to work life coaching online can help with the steps to attract the wanted results most of the time the wanted results are a cause of positive effects on a person lifefollow us : http:findhappinessnetboardme |
|
3tv reporter jaime cerreta caught in dust storm
Bookmarked 597 weeks ago as the first dust storm of monsoon 2014 hit the valley 3tv reporter jaime cerreta ended up reporting from one of the hardest hit areas as the first dust storm of monsoon 2014 hit the valley 3tv reporter jaime cerreta ended up reporting from one of the hardest hit areas as the first dust storm of monsoon 2014 hit the valley 3tv reporter jaime cerreta ended up reporting from one of the hardest hit areas 3tv reporter jaime cerreta caught in dust storm3tv reporter jaime cerreta caught in dust storm3tv reporter jaime cerreta caught in dust stormnewsphoenixarizonaphoenix videosarizona videosnews videosweathersportsphoenix newsfeatured videotravel weather |
|
low 3-d flyover of jupiters north pole in infrared
Bookmarked 400 weeks ago in this animation the viewer is taken low over jupiters north pole to illustrate the 3-d aspects of the regions central cyclone and the eight cyclones that encircle it read more: https:wwwnasagovfeaturejplnasa-s-juno-mission-provides-infrared-tour-of-jupiter-s-north-polethe movie utilizes imagery derived from data collected by the jovian infrared auroral mapper jiram instrument aboard nasa039s juno mission during its fourth pass over the massive planet infrared cameras are used to sense the temperature of jupiters atmosphere and provide insight into how the powerful cyclones at jupiter039s poles work in the animation the yellow areas are warmer or deeper into jupiters atmosphere and the dark areas are colder or higher up in jupiters atmosphere in this picture the highest brightness temperature is around 260k about -13c and the lowest around 190k about -83c the brightness temperature is a measurement of the radiance at 5 m traveling upward fro |
|
voodoo full documentary
Bookmarked 465 weeks ago the slave ships during the xvii and xviii century transported millions of colored people from africa to america carried within it the seed of a religious cult that would help the slaves in the confederacy for their freedom this is the story of the formation of african roots syncretic cults that worship spirits of two faces: black continent mystical entities hidden behind catholic imageryin haiti reminisced gucaimn night in which the slaves made a pact with the devil breaking their chains giving rise to the legendary voodoo rites we will witness the ceremonies of possession where participants fall into a deep trance that allows marriages mystics we will approach the lakus towns built around temples which demonstrate the integration of these beliefs in all areas of life we are also open the gates of cemeteries hosting nightly ritual of communion with leading spirits or orexs and know the truth about the mysterious haitian zombiescuba is the birthplace of santeria yoruba syncretic cults |
|
man in 457 mph wind: quothuman tolerance to wind blastsquot 1946 naca langley research center
Bookmarked 398 weeks ago more at http:scitechquickfoundnetquottest conducted in 1946 where a human subject was exposed to blasts of air the test was performed at nasa langley research center039s 8 ft high speed tunnelquot silentreupload of a previously uploaded film with improved videopublic domain film from the library of congress prelinger archives slightly cropped to remove uneven edges with the aspect ratio corrected and one-pass brightness-contrast-color correction amp mild video noise reduction appliedhttp:creativecommonsorglicensesby-sa30http:enwikipediaorgwikiwindwind is the flow of gases on a large scale on earth wind consists of the bulk movement of air in outer space solar wind is the movement of gases or charged particles from the sun through space while planetary wind is the outgassing of light chemical elements from a planet039s atmosphere into space winds are commonly classified by their spatial scale their speed the types of forces that cause them the regions |
|
3 reasons not to stack rocks in wilderness areas
Bookmarked 396 weeks ago rock stacking has exploded in popularity in recent years due largely to social media however many people fail to realise this is akin to environmental graffiti so in this video we talk about 3 reasons people should not stack rocks in wilderness areas1 rock stacking is irresponsible long before balancing stones became trendy park rangers and game wardens built stone cairns as markers to keep people from getting lost when people stack stones everywhere suddenly the one marking an important bend in the track looses its meaning which could lead to someone getting lost2 rock stacking is inconsiderate millions of people around the world venture into wilderness areas to escape civilisation and experience untouched environments in the eyes on many people seeing man made stone cairns everywhere they go is no different to finding people have graffitied a cliff face with spray paint or left litter lying around as such the act of balancing stones can actually impede on other peoples a |
|
electromagnetic railgun firing hypervelocity projectile mach 7
Bookmarked 332 weeks ago watch hyper velocity projectile hvp being demonstrated at us navy039s research labsthe hvp is a next-generation common low drag guided projectile capable of completing multiple missions for gun systems such as the navy 5-inch 155-mm and future railguns types of missions performed will depend on gun system and platform the program goal is to address mission requirements in the areas of naval surface fire support cruise missile defense anti-surface warfare and other future naval mission areas hvps low drag aerodynamic design enables high-velocity maneuverability and decreased time-to-target these attributes coupled with accurate guidance electronics provide low-cost mission effectiveness against current threats and the ability to adapt to air and surface threats of the future wwwonrnavymilenmedia-centerfact-sheetshypervelocity-projectileaspxquotenergetic weapons such as em railguns are the future of naval combatquot said rear adm matt klunder the chief of naval re |
|
oceana cape arago rov footage
Bookmarked 729 weeks ago underwater video taken by a remotely operated vehicle rov from 30-40 meters depth around the cape aragoseven devils reef area of the oregon coast footage showcases several species of rockfish gorgonian corals anemones sea stars and other invertebrates and their habitats the rov was operated by oceana as part of our 2011 pacific hotspots expedition documenting important ecological areas in monterey bay the southern oregon coast and the san juan islands off washington in june 2011 |
|
fighting back against isis: the battle for iraq dispatch 1
Bookmarked 599 weeks ago subscribe to vice news here: http:bitlysubscribe-to-vice-newslast week the extremist militant sunni group islamic state of iraq and syria isis along with other sunni militias and former baathist party members seized control of large parts of iraq including mosul the nation039s second largest city in many places the iraqi army barely put up a flight soldiers dropped their weapons and fled whether because of fear incompetence or internal sabotage hundreds of thousands of iraqis have become internally displaced after fleeing the fighting or the potential for potential iraqi air strikesas isis and the other groups continued to fight their way to baghdad gruesome videos of brutal executions began to surface iraqi army units stationed near baghdad as well as shiite militias have pledged to not give up so easily many say the conflict was brewing for a while and that isis along with some of the other groups has had some semblance of control in sunni areas for quite some time they point to iraqi prime minister nouri al-maliki039s increasingly sectarian polices and crackdowns on sunnis as having provoked the events of the last week and fear this could be the start of a devastating civil war in the north kurdish forces known as the peshmerga have used the opportunity to seize disputed areas territories that the kurds long felt belonged to them but the government was hesitant relinquish an informal border now exists between isis dominated areas and kurdish territory there has only been sporadic clashing as neither group seems determined to break the strange detente crisis in iraq: kurdish peshmerga clash with advancing isis: http:bitly1ye4tgfcheck out the vice news beta for more: http:vicenewscomfollow vice news here:facebook: https:wwwfacebookcomvicenewstwitter: https:twittercomvicenewstumblr: http:vicenewstumblrcom |
|
sports and safety surfaces
Bookmarked 535 weeks ago sports and safety surfaces is a market leader in sports and safety surfaces for a variety of facilities including artificial turf pitches athletics tracks and multi use sports areas we have a service second to none and are able to carry out small repairs on wetpour playground surfacing to full construction on synthetic turf all weather pitches |
|
man in 457 mph wind: quothuman tolerance to wind blastsquot 1946 naca langley research center
Bookmarked 521 weeks ago more at http:scitechquickfoundnetquottest conducted in 1946 where a human subject was exposed to blasts of air the test was performed at nasa langley research center039s 8 ft high speed tunnelquot silentpublic domain film from nasa slightly cropped to remove uneven edges with the aspect ratio corrected and mild video noise reduction appliedhttp:creativecommonsorglicensesby-sa30http:enwikipediaorgwikiwindwind is the flow of gases on a large scale on earth wind consists of the bulk movement of air in outer space solar wind is the movement of gases or charged particles from the sun through space while planetary wind is the outgassing of light chemical elements from a planet039s atmosphere into space winds are commonly classified by their spatial scale their speed the types of forces that cause them the regions in which they occur and their effect the strongest observed winds on a planet in our solar system occur on neptune and saturnin meteorology winds are often referred to according to their strength and the direction from which the wind is blowing short bursts of high speed wind are termed gusts strong winds of intermediate duration around one minute are termed squalls long-duration winds have various names associated with their average strength such as breeze gale storm hurricane and typhoon wind occurs on a range of scales from thunderstorm flows lasting tens of minutes to local breezes generated by heating of land surfaces and lasting a few hours to global winds resulting from the difference in absorption of solar energy between the climate zones on earth the two main causes of large-scale atmospheric circulation are the differential heating between the equator and the poles and the rotation of the planet coriolis effect within the tropics thermal low circulations over terrain and high plateaus can drive monsoon circulations in coastal areas the sea breezeland breeze cycle can define local winds in areas that have variable terrain mountain and valley breezes can dominate local windsin human civilization wind has inspired mythology influenced the events of history expanded the range of transport and warfare and provided a power source for mechanical work electricity and recreation wind powers the voyages of sailing ships across earth039s oceans hot air balloons use the wind to take short trips and powered flight uses it to increase lift and reduce fuel consumption areas of wind shear caused by various weather phenomena can lead to dangerous situations for aircraft when winds become strong trees and man-made structures are damaged or destroyedwinds can shape landforms via a variety of aeolian processeshttp:crgisndcnasagovhistoric6418-foot high speed tunnelas interest in the field of high-speed aerodynamics increased in the early 1930s langley039s existing wind tunnels proved too small and underpowered for effective high-speed aircraft testing understanding that a new facility would give us engineers a decided advantage in the aeronautical field langley039s director of research george w lewis authorized the design and construction of a larger high speed wind tunnel in 1933 construction of the 8-foot high speed tunnel hst was funded by the public works administration pwa and completed in 1936 at a cost of 266000the world039s first large high speed tunnel the hst proved vital during world war iihttp:enwikipediaorgwikijohn_stappwind-blast_experimentswind-blast experimentsstapp also participated in wind-blast experiments in which he flew in jet aircraft at high speeds to determine whether or not it was safe for a pilot to remain with his aircraft if the canopy should accidentally blow off stapp stayed with his aircraft at a speed of 570 mph 917 kmh with the canopy removed and suffered no injurious effects from the wind blasts among these experiments was one of the first high-altitude skydives executed by stapp himself he also supervised research programs in the fields of human factors in escape from aircraft and human tolerance to abrupt acceleration and deceleration |
|
severe thunderstorms to hit dallas texas on thursday may 8 2014
Bookmarked 605 weeks ago severe thunderstorms is on its way for dallas texas on thursday may 8 2014 and it will bring 30 mm of rain especially in thunderstorms and it will bring chain lightning and loud thunder and it will bring heavy downpours and gusty winds especially in thunderstorms and it will be bad thunderstorms and the cold front will be going through dallas on thursday and the warm moist air coming from the gulf of mexico and the cool dry air coming from the northern united states that will cause severe thunderstorms and it will bring a lot of rain in dallas and the surrounding areas on thursday and people in dallas texas be prepared have your rubber boots rain coats and rain suits ready and order your pizzas and chinese food and buy cases of pepsi and coke and have your ipads ipods cell phones laptops and tablets charged and have your 3g and 4g internet ready and when the thunderstorms happens unplug all your electronics such as televisions computers gaming consoles and stereos so you don039t get a power surge and don039t walk through the deep puddles and avoid the puddles when you are going for a walk and when the during thunderstorms stay away from underneath the tree and open fields such as golf courses and when the thunderstorms happens get inside of your house so you can be safe during severe thunderstorms on thursday if you have anybody living in dallas texas fort worth texas and surrounding areas be prepared for the severe thunderstorms on thursday |
|
brain anatomy and functions
Bookmarked 754 weeks ago http:wwwnucleusinccommedical-animationbrain anatomy and function this 3d animation shows the anatomy and function of the brain using color coded areas |















