Tag results for alternative
sort by: relevance | recent
Results from all user's collections (6178 out of ~6,178)
|
the offspring - you039re gonna go far kid
Bookmarked 738 weeks ago music video by the offspring performing you039re gonna go far kid c 2008 sony bmg music entertainment |
|
john prine - it039s a big old goofy world
Bookmarked 790 weeks ago live performance of the song off his excellent album the missing years no copyright infringement intended if copyright owner wishes the video to be removed please contact me directly thanks |
|
the raveonettes - heart of stone
Bookmarked 750 weeks ago music video by the raveonettes performing heart of stone |
|
sonic youth - superstar
Bookmarked 750 weeks ago music video by sonic youth performing superstar c 2004 geffen records |
|
kings of leon - sex on fire
Bookmarked 759 weeks ago music video by kings of leon performing sex on fire c 2008 rca records a unit of sony bmg music entertainment |
|
kings of leon - use somebody
Bookmarked 759 weeks ago music video by kings of leon performing use somebody c 2008 rca records a unit of sony music entertainment |
|
30 seconds to mars - hurricane official video edit
Bookmarked 759 weeks ago now on facebook join and share : http:wwwfacebookcompagesnarcizusrecords141639585897700my own edited official clip version i hope you like itall songs mixes and remixes are the property of their respective owners the owner will let me know if he doesnt want his tracks to be posted here thank you |
|
the winners of the 2013 telly award for reiki healing techniques - aesthetic videosource
Bookmarked 635 weeks ago 1888pressrelease - aesthetic videosource wins telly award for reiki healing techniques online training video and dvdanyone can now easily learn reiki laiya moniak renowned usui reiki master and teacher demonstrates self-healing and meditation a complete client session to re-balance mind and body an attunement and long-distance healing in this reiki dvd and online reiki video |
|
finding the renewable sources of energy
Bookmarked 436 weeks ago in agrisoma we promote carinata a non-food certified sustainable crop that delivers oil for biofuels and protein for animal nutrition it is a scalable solution that meets the demand for cleaner energy and animal nutrition while improving food security and strengthening the farming system get in touch with us now to learn more about us http:growcarinatacom |
|
alternative treatment of itp immune thrombocytopenic purpura - real testimonial
Bookmarked 392 weeks ago immune thrombocytopenia purpura itp is a blood disorder in which the number of platelets in the blood is decreased to low levels this can be dangerous because people depend on platelets to help stop bleeding read more - https:googl7f5urd |
|
alternative meaghan anal tease
Bookmarked 59 weeks ago watch alternative meaghan anal tease 2024 runtime: 06:24 categories: alternative anal tease hornyhill hornyhillse |
|
redandwild0
Bookmarked 57 weeks ago watch redandwild0 2015 runtime: 13:40 categories: tattoo webcam alternative hornyhill hornyhillse |
|
cp security - google wallet apple pay amp paypal credit card alternative
Bookmarked 570 weeks ago cp security - http:wwwcp-secinfo - is now developing a mobile phone credit card processing platform called receiptpass which secure credit and debit card users from fraud cp security inc has filed 7 innovative technology patents the company is seeking investors to deploy its new receiptpass technology cp security039s brand card doctor has sold over 1 million units to protect credit cards |
|
die gnstige alternative zum pflegeheim rostock demenz wohngemeinschaft
Bookmarked 584 weeks ago wwwmelita-intensivpflegedienstdedie gnstige alternative zum pflegeheim rostock demenz wohngemeinschaft willkommen bei melita intensivpflegedienst in rostock unsere leistungen umfassen: intensivpflege pflege in der huslichkeit und in der wohngemeinschaft fr erwachsene und kinder ambulanter intensivpflegedienst mit umfassender intensivmedizinischer betreuung versorgung und behandlungspflege pflege in der huslichkeit oder unterbringung in einer wohngemeinschaft garantiert eine aktivierende pflege betreuung von kindern intensivmedizin sowie beatmungspflege sie erreichen uns telefonisch unter: 0381 210 517 25 oder per e-mail unter: infomelita-intensivpflegedienstdedie gnstige alternative zum pflegeheim demenz wohngemeinschaft rostock |














